![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66551959 XP_395324.2 PREDICTED: charged multivesicular body protein 4b |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 76* | 24 | 3.1666667 | ||
| Leg, front | 67.1 | 32.9 | 2.0395136 | ||
| Leg, middle | 57.7 | 42.3 | 1.3640662 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 61.6 | 38.4 | 1.6041666 | ||
| Sternite | |||||
| Tergite | 78.6 | 21.4 | 3.672897 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 40.5 | 28.3 | 31.2 | 1.2980769 | 0.90705127 |
| Malpighian tubules | 47.4 | 52.6 | 0.9011407 | ||
| Nerve chord | 34 | 33.3 | 32.7 | 1.0397553 | 1.0183486 |
| Poison sac | |||||
| Sting | |||||
| Heart | 19.6 | 46.9 | 33.4 | 0.5868263 | 1.4041916 |
| Hypopharyngeal gland | 48.5 | 51.5 | 0.94174755 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 49.4 | 49.1 | 36 | 1.3722222 | 1.3638889 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSFFSKVFGGKKEAAPLSTADAIQKLRETEDMLIKKQDFLENKIEIEIQTAKKHGTKNKR AAIQALKRKKRYEKQLQQIDGTLTTIESQREALECANTNTAVLTTMKNAADALKSVHQHM DVDQVHDMMDDIAEQQDVAREISDAISNPVAFGQDVDEEELEKELEELEQEQLDKELLGI EPTDELPNVPATAIPTAPTRTRTKAKPEEDEDLKELEAWAS |
|
| |