| Protein: 110764289 XP_001122959.1 PREDICTED: calcium/calmodulin-dependent protein kinase type 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 52.1 | 47.9 | 1.0876827 | ||
| Scape | 19.8 | 80.2 | 0.2468828 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 54.9 | 45.1 | 1.2172949 | ||
| Leg, middle | |||||
| Leg, rear | 72.6 | 27.4 | 2.649635 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 41 | 26.7 | 32.3 | 1.2693498 | 0.8266254 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 58.5 | 41.5 | 1.4096385 | ||
| Malpighian tubules | 47.4 | 34.1 | 18.5 | 2.5621622 | 1.8432432 |
| Nerve chord | 34.6 | 33.9 | 31.5 | 1.0984128 | 1.0761905 |
| Poison sac | |||||
| Sting | |||||
| Heart | 9.1 | 54.5 | 36.4 | 0.25 | 1.4972527 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.5 | 37.9 | 40.1 | 1.1097257 | 0.94513714 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPLFGKKDSNKKIKKDGKDDKSPSVEDKYILKELLGTGAFSEVRLAESREKPGQMFAVKI IDKKALKGKEDSLENEIRVLRRLTHPNIVQLLETFEDKHKVYLVMELVTGGELFDRIVEK GSYTEKDASGLIRQVLEAVDYMHDQGVVHRDLKPENLLYYNPDEDSKIMISDFGLSKMED SGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQIL KGEFEFDSPYWDDISDSAKDFIHKLMCVNVEERYSCKQALAHPWISGNAASNKNIHGTVS EQLKKNFAKSRWKQAYHAATVIRQMQRLALNSGQQQQGPGSTGPSSGNLMPYPDQSQSNP SHQSRSVESPTNHN |
 Top
| |