| Protein: 110760326 XP_001122389.1 PREDICTED: PDZ and LIM domain protein 3 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 37.7 | 24.2 | 38.1 | 0.9895013 | 0.6351706 |
| Brain | |||||
| Crop | 20.4 | 46.6 | 33.1 | 0.6163142 | 1.407855 |
| Eye | |||||
| Intestine | 59.5 | 40.5 | 1.4691358 | ||
| Leg, front | 21.6 | 42.2 | 36.2 | 0.5966851 | 1.1657459 |
| Leg, middle | 39.3 | 25.9 | 34.8 | 1.1293104 | 0.74425286 |
| Leg, rear | 32.2 | 29.2 | 38.6 | 0.83419687 | 0.7564767 |
| Mandibular gland | 19.5 | 47 | 33.5 | 0.58208954 | 1.4029851 |
| Rectum | |||||
| Salivary gland, cerebral | 10.9 | 9.4 | 79.7 | 0.13676286 | 0.11794228 |
| Salivary gland, thoracic | 31.6 | 49.3 | 19.1 | 1.6544503 | 2.5811517 |
| Sternite | 62.3 | 19.9 | 17.8 | 3.5 | 1.1179775 |
| Tergite | 82.1 | 8.9 | 9 | 9.122222 | 0.98888886 |
| Ventriculus | |||||
| Thoracic muscle | 59.3 | 40.7 | 1.4570024 | ||
| Fat body | 7.4 | 90.5* | 2.1 | 3.5238094 | 43.095238 |
| Malpighian tubules | 74.2* | 18.6 | 7.2 | 10.305555 | 2.5833333 |
| Nerve chord | 21.6 | 4.2* | 74.2 | 0.29110512 | 0.056603774 |
| Poison sac | |||||
| Sting | 28.6 | 71.4 | 0.40056023 | ||
| Heart | 44.5 | 19.2 | 36.3 | 1.2258953 | 0.5289256 |
| Hypopharyngeal gland | |||||
| Galea | 23.7 | 53.7 | 22.5 | 1.0533333 | 2.3866668 |
| Glossa | 29.1 | 33.4 | 37.5 | 0.776 | 0.89066666 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.3 | 33.9 | 35.4 | 1.0254238 | 0.9576271 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTRKQTIIVKLKRSSTGKPWGIRIAGGADLGTPIVVTRSENETLQRGDVIKKIDDYDARD VRHVDAQNLLQNSESIRLVIERSEPSKASRINIRTTSSSIFESNTGDRAAVTSLAKQRKL PAELPKSPVPPPSIDEYNRPSSSPDRLYLPHEHLDEVREERAYLSQPYRTTPLVLPGAKI KKDAPLGECYLRHHPNPMIRAAPHHYEPAHPEVAMKQKVAETVLQRVLGPNEVPKVVHKQ FNSPIGLYSEENIADTIKCQASAIPPKKPMKYDPSKSEAYKALQEEALGDTVQEVKQPAR TGVFSPQKVNQNRIYHARPKSPAGPYVNILDDDGEKIHQSNSFKRIMYSVLGQTDY |
 Top
| |