| Protein: 328785025 XP_624156.3 PREDICTED: ATP synthase subunit beta mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.5 | 32.8 | 33.7 | 0.9940653 | 0.9732938 |
| Scape | 36.7 | 30 | 33.4 | 1.0988024 | 0.8982036 |
| Brain | 27 | 36.1 | 36.9 | 0.73170733 | 0.97831976 |
| Crop | 28.8 | 39 | 32.2 | 0.89440995 | 1.2111801 |
| Eye | 39.7 | 23.1 | 37.2 | 1.0672044 | 0.62096775 |
| Intestine | 32.2 | 29.7 | 38.1 | 0.84514433 | 0.77952754 |
| Leg, front | 33.2 | 27.2 | 39.6 | 0.83838385 | 0.68686867 |
| Leg, middle | 35.3 | 28.7 | 36 | 0.98055553 | 0.7972222 |
| Leg, rear | 23.7 | 34 | 42.3 | 0.56028366 | 0.8037825 |
| Mandibular gland | 80.2 | 1.5 | 18.4 | 4.3586955 | 0.08152174 |
| Rectum | 24.7 | 41.7 | 33.6 | 0.73511904 | 1.2410715 |
| Salivary gland, cerebral | 28.4 | 34.3 | 37.3 | 0.7613941 | 0.91957104 |
| Salivary gland, thoracic | 38.5 | 30.2 | 31.3 | 1.230032 | 0.9648562 |
| Sternite | 26.1 | 38.9 | 35 | 0.7457143 | 1.1114286 |
| Tergite | 26.5 | 31.1 | 42.4 | 0.625 | 0.7334906 |
| Ventriculus | 23.9 | 22.6 | 53.5 | 0.44672897 | 0.42242992 |
| Thoracic muscle | 23.7 | 52.6 | 23.7 | 1 | 2.2194092 |
| Fat body | 35.4 | 46.1 | 18.5 | 1.9135135 | 2.4918919 |
| Malpighian tubules | 35.9 | 27.8 | 36.3 | 0.9889807 | 0.76584023 |
| Nerve chord | 33.9 | 15.5 | 50.6 | 0.6699605 | 0.30632412 |
| Poison sac | 58.5 | 41.5 | 1.4096385 | ||
| Sting | 48.7 | 51.3 | 0.94931775 | ||
| Heart | 49.5 | 15.9 | 34.5 | 1.4347826 | 0.46086955 |
| Hypopharyngeal gland | 91.7 | 8.3 | 11.048193 | ||
| Galea | 44.1 | 24.5 | 31.4 | 1.4044586 | 0.7802548 |
| Glossa | 42.6 | 25.2 | 32.1 | 1.3271028 | 0.78504676 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.9 | 34.1 | 35 | 0.99714285 | 0.9742857 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLNVVSKAAAGALRAVKPSILQNEITKISGALSVNSRDYAKAASSKGGAQGKIVAVIGAV VDVQFDDALPPILNALEVQNRTPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQSVLDSGY PIRIPVGAETLGRIINVIGEPIDERGPIPTDKLAPIHADAPEFVDMSVEQEILVTGIKVV DLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEM IESGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFR FTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDP APATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGAEHYNVARGVQKILQD YKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLEETIKG FKKILAGDYDHLPEVAFYMIQLMDFPVDKYFSGSKI |
 Top
| |