| Protein: 66525867 XP_396960.2 PREDICTED: phosphate carrier protein mitochondrial-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 34.8 | 27.1 | 38.1 | 0.9133858 | 0.71128607 |
| Scape | 31.6 | 26.5 | 41.9 | 0.7541766 | 0.6324582 |
| Brain | 24.7 | 33.6 | 41.7 | 0.59232616 | 0.8057554 |
| Crop | 43.2 | 28 | 28.7 | 1.5052265 | 0.9756098 |
| Eye | 28 | 25.2 | 46.8 | 0.5982906 | 0.53846157 |
| Intestine | 33.8 | 20.9 | 45.3 | 0.74613684 | 0.46136865 |
| Leg, front | 31.2 | 32 | 36.9 | 0.8455285 | 0.86720866 |
| Leg, middle | 32.8 | 30.1 | 37.1 | 0.88409704 | 0.8113208 |
| Leg, rear | 31.8 | 34.9 | 33.3 | 0.954955 | 1.048048 |
| Mandibular gland | 75.3 | 24.7 | 3.048583 | ||
| Rectum | 23.8 | 50.2 | 25.9 | 0.9189189 | 1.938224 |
| Salivary gland, cerebral | 36.3 | 25.5 | 38.3 | 0.94778067 | 0.66579634 |
| Salivary gland, thoracic | 41.6 | 25.1 | 33.3 | 1.2492492 | 0.7537538 |
| Sternite | 23.7 | 21.4 | 55 | 0.4309091 | 0.3890909 |
| Tergite | 38.4 | 24.4 | 37.2 | 1.032258 | 0.65591395 |
| Ventriculus | |||||
| Thoracic muscle | 15.6 | 71.2 | 13.3 | 1.1729324 | 5.3533835 |
| Fat body | 27.2 | 30.3 | 42.5 | 0.64 | 0.71294117 |
| Malpighian tubules | 32.8 | 33.5 | 33.7 | 0.9732938 | 0.9940653 |
| Nerve chord | 12.9 | 53.7 | 33.4 | 0.38622755 | 1.6077844 |
| Poison sac | |||||
| Sting | 65.1 | 34.9 | 1.8653295 | ||
| Heart | 24.1 | 39.9 | 36 | 0.66944444 | 1.1083333 |
| Hypopharyngeal gland | 62 | 38 | 1.6315789 | ||
| Galea | 39.7 | 30.3 | 30 | 1.3233334 | 1.01 |
| Glossa | 45.5 | 20.2 | 34.3 | 1.3265306 | 0.5889213 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.1 | 35.3 | 35.8 | 0.924581 | 0.9860335 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MWPSILDVAKMNPFGTPFVTTTCQRQNELTQALVKNRHIAAASVASGDSCEFGSNKYFML CGLGGILSCGITHTLVTPLDLVKCRIQVNPAKYKSVFNGFRVTLAEDGTRGLVKGWAPTF FGYSIQGMFKFGLYEIFKVYYSALAGEEMAYEFRTSLYLISSATAEFFADIGLAPLEAAK VKIQTTPGFANTLREAMPKIYAEEGITGFYKGLVPLWLRQVPYTMMKFACFERTLELLYK YVVPKPRQECSKGEQLVVTFAAGYIAGVFCAIVSHPADSVVSKLNQEKGASAIDVLRKLG FGGVWKGLGPRIVMIGTLTGAQWFIYDAVKVWLRMPRPPPPEMPESLKKKYGLA |
 Top
| |