| Protein: 66534614 XP_393287.2 PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 2 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.2 | 32.6 | 34.2 | 0.9707602 | 0.9532164 |
| Scape | 47.7 | 20.6 | 31.6 | 1.5094937 | 0.65189874 |
| Brain | 47.6 | 52.4 | 0.90839696 | ||
| Crop | 30.3 | 36.7 | 33 | 0.91818184 | 1.1121212 |
| Eye | 34.6 | 27.4 | 38 | 0.91052634 | 0.72105265 |
| Intestine | 30.4 | 28.7 | 40.9 | 0.7432763 | 0.7017115 |
| Leg, front | 11.3* | 45.1 | 43.6 | 0.25917432 | 1.0344037 |
| Leg, middle | 35.4 | 44.4 | 20.2 | 1.7524753 | 2.1980197 |
| Leg, rear | 22 | 40.6 | 37.4 | 0.5882353 | 1.0855615 |
| Mandibular gland | 64 | 2.7 | 33.4 | 1.9161676 | 0.08083832 |
| Rectum | 47.6 | 29.3 | 23.1 | 2.060606 | 1.2683983 |
| Salivary gland, cerebral | 23.1 | 36 | 40.9 | 0.56479216 | 0.8801956 |
| Salivary gland, thoracic | 26.2 | 45.7 | 28.1 | 0.9323844 | 1.6263345 |
| Sternite | 30.9 | 33.5 | 35.6 | 0.8679775 | 0.94101125 |
| Tergite | 27.6 | 24.5 | 47.8 | 0.57740587 | 0.5125523 |
| Ventriculus | |||||
| Thoracic muscle | 11.7 | 75.3 | 13 | 0.9 | 5.792308 |
| Fat body | 26.4 | 53.7 | 19.9 | 1.3266332 | 2.6984925 |
| Malpighian tubules | 39.9 | 25.2 | 34.9 | 1.1432664 | 0.72206306 |
| Nerve chord | 43.5 | 18 | 38.5 | 1.1298702 | 0.46753246 |
| Poison sac | |||||
| Sting | 33.2 | 66.8 | 0.497006 | ||
| Heart | 50.5 | 16.8 | 32.8 | 1.5396341 | 0.5121951 |
| Hypopharyngeal gland | 87.6 | 12.4 | 7.064516 | ||
| Galea | 35.6 | 36.1 | 28.3 | 1.2579505 | 1.2756184 |
| Glossa | 49.3 | 17.6 | 33.1 | 1.489426 | 0.53172207 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.3 | 35.8 | 34.2 | 1.002924 | 1.0467836 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFPSLYTIRTFFNYKNVRRLQTSIIRTSDQLFVHRDSEVDNPSIPFEFNEANKKRIEALL KIYPEGHKRGAMIPLLDLAQRQYGWLPISAMHKVAEILNIPRMRVYEVATFYTMFNRRPM GKYHVQICTCTPCWLRDSDSIVEAVTKVTNCKVGEMSADKLFTVSEVECLGACANAPMFQ VNDDYYEDLTPESAISIINAFKKGERPPPGPQNSPRFAADPAGGLTSLTSPPPGPGFGVR SDL |
 Top
| |