| Protein: 66522157 XP_623476.1 PREDICTED: putative gamma-glutamylcyclotransferase CG2811-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.6 | 55.4 | 0.8050541 | ||
| Scape | 27.9 | 41.9 | 30.2 | 0.92384106 | 1.3874172 |
| Brain | |||||
| Crop | 43.4 | 56.6 | 0.7667844 | ||
| Eye | |||||
| Intestine | 10* | 26.3 | 63.7 | 0.15698586 | 0.41287285 |
| Leg, front | 31.4 | 34.7 | 33.8 | 0.92899406 | 1.0266272 |
| Leg, middle | 32 | 34.9 | 33.1 | 0.9667674 | 1.0543807 |
| Leg, rear | 38.3 | 30 | 31.7 | 1.2082019 | 0.9463722 |
| Mandibular gland | 11.5 | 88.5 | 0.1299435 | ||
| Rectum | |||||
| Salivary gland, cerebral | 78.3 | 6.4 | 15.3 | 5.117647 | 0.41830066 |
| Salivary gland, thoracic | 36.4 | 26.4 | 37.2 | 0.97849464 | 0.7096774 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 1.1* | 98.9 | 0.011122346 | ||
| Thoracic muscle | 2.6* | 97.4 | 0.026694044 | ||
| Fat body | 23.6 | 42 | 34.4 | 0.68604654 | 1.2209302 |
| Malpighian tubules | 26.6 | 36.6 | 36.8 | 0.72282606 | 0.9945652 |
| Nerve chord | 31.5 | 37.9 | 30.6 | 1.0294118 | 1.2385621 |
| Poison sac | |||||
| Sting | 57.1 | 42.9 | 1.3310024 | ||
| Heart | 28.1 | 37.5 | 34.3 | 0.819242 | 1.0932945 |
| Hypopharyngeal gland | 89.1 | 10.9 | 8.174312 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.2 | 36.4 | 46.2 | 0.65367967 | 0.7878788 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLFHIAAAAVLTNIAFLEIYTLYDLPKIEDISFLSNKNPLQRVFVYGTLKRGEPNHCLIQ DTENGYAKFLGLGRTTIPYPLIIATDYNIPFLLKKPGFGHHVFGEVYDVDSKMLKKLDEL EEHPAFYKRSEENVLFAPESKVKSMDKFEEVSTLIKVWIYFLPKFKTSLLEKPMYSSYSN EGSHGLKYCENEESTIRPEDLF |
 Top
| |