Home List proteins by tissue Protein search Downloads Links
Protein: 328775921 XP_397330.3 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 mitochondrial isoform 1
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 46.4 53.6 0.86567163
Scape 43.1 18.7 38.2 1.1282723 0.4895288
Brain 38.7 61.3 0.6313214
Crop 27.3 49.6 23.1 1.1818181 2.147186
Eye 53 47 1.1276596
Intestine 34.8 24.8 40.4 0.8613861 0.6138614
Leg, front 14.1* 46.6 39.3 0.35877863 1.1857506
Leg, middle 25.7 48.2 26.1 0.98467433 1.8467433
Leg, rear 16.2 37.9 45.9 0.3529412 0.82570803
Mandibular gland
Rectum
Salivary gland, cerebral 14.1 46.2 39.7 0.35516372 1.163728
Salivary gland, thoracic 26.2 47.5 26.3 0.9961977 1.8060837
Sternite 30.6 19.4 50 0.612 0.388
Tergite 60 40 1.5
Ventriculus
Thoracic muscle 49.5 50.5 0.980198
Fat body 28.9 39.3 31.8 0.908805 1.235849
Malpighian tubules 32.1 34.3 33.6 0.95535713 1.0208334
Nerve chord 21 43.7 35.4 0.59322035 1.2344633
Poison sac
Sting 31.4 68.6 0.45772594
Heart 28.8 30.4 40.8 0.7058824 0.74509805
Hypopharyngeal gland 88.3 11.7 7.5470085
Galea 39.2* 46.9* 13.8 2.8405797 3.3985507
Glossa 39 14.4 46.6 0.8369099 0.3090129
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 32 40 39.3 0.81424934 1.0178117
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MKMTVRALGPFFRSNNLLFRTLNENVVTNNRIIPLVNIESQRREAHQWMPDLDEYKHLLK
HECTKILATKEKIWPYIKPSWNEPQTVSQLTPEFRNVVINFGPQHPAAHGVLRLLIEMNS
EYVTRADPHIGLLHRGTEKLVEYKTYMQALPYFDRLDYVSMMCNEQCFSMAIEKLLNIDI
PLRAKYIRTLFAEITRILNHIMNIGTHALDIGALTPFFWLFEEREKLMEFYERVSGARMH
AAYIRPGGVSLDMPLGLLDDIYEWSSKFTLRLDEIEDLLTENRVWTGRTKDIGVVTAEQA
IEWGFSGVMLRGSGIQWDIRKKTPYDAYDLVEFDVPIGLKGDCYDRYLCRMEEMRQSLRI
IYQCLNQMPEGEVRIDDAKIVPPRREEMKTSMEALIHHFKLYTQGFQVPPGSTYTAIEAP
KGEFGVYLVSDGSSRPYRCKIKAPGFAHLAALRHMGPGCLLADIVAIIGTLDVVFGEIDR

Top