| Protein: 48120572 XP_396465.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 67.7* | 18.4 | 13.9 | 4.8705034 | 1.323741 |
| Scape | 39.5 | 17.8 | 42.8 | 0.9228972 | 0.41588786 |
| Brain | 47.5 | 52.5 | 0.9047619 | ||
| Crop | 27.9 | 41.9 | 30.2 | 0.92384106 | 1.3874172 |
| Eye | 71.5 | 12.2 | 16.3 | 4.386503 | 0.74846625 |
| Intestine | 27.3 | 30.7 | 42 | 0.65 | 0.7309524 |
| Leg, front | 27.1 | 33.1 | 39.8 | 0.6809045 | 0.8316583 |
| Leg, middle | 39.2 | 32.5 | 28.3 | 1.385159 | 1.1484098 |
| Leg, rear | 19.1 | 43.9 | 37 | 0.5162162 | 1.1864865 |
| Mandibular gland | 48.7 | 26.5 | 24.8 | 1.9637097 | 1.0685484 |
| Rectum | |||||
| Salivary gland, cerebral | 39.4 | 31.4 | 29.2 | 1.349315 | 1.0753424 |
| Salivary gland, thoracic | 30.4 | 41 | 28.7 | 1.0592334 | 1.4285715 |
| Sternite | 26.2 | 33.3 | 40.4 | 0.64851487 | 0.82425743 |
| Tergite | 26.6 | 23.2 | 50.1 | 0.53093815 | 0.46307385 |
| Ventriculus | |||||
| Thoracic muscle | 10.1 | 77 | 12.9 | 0.78294575 | 5.968992 |
| Fat body | 31.3 | 51.6 | 17.1 | 1.8304094 | 3.0175438 |
| Malpighian tubules | 47.4 | 21.8 | 30.8 | 1.538961 | 0.7077922 |
| Nerve chord | 49.4 | 12.5 | 38.1 | 1.296588 | 0.328084 |
| Poison sac | |||||
| Sting | 38.2 | 61.8 | 0.618123 | ||
| Heart | 57.9 | 15.6 | 26.4 | 2.1931818 | 0.59090906 |
| Hypopharyngeal gland | 76.4 | 23.6 | 3.2372882 | ||
| Galea | 37.9 | 29.4 | 32.7 | 1.1590214 | 0.89908254 |
| Glossa | 44.5 | 27.8 | 27.8 | 1.6007195 | 1 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.5 | 34.1 | 32.5 | 1.1846154 | 1.0492308 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSKILKKTTGLTGLAVSSNPRLELSVLYDRILRLSSHLPKEYIYRKSVENLAKERMNIVK ENENIAVIEEKINQGQVEELINHAKNEIFLIQDIIEQRPWENLMEKAPPHQWTWPAYK |
 Top
| |