| Protein: 328782037 XP_624147.2 PREDICTED: cytochrome b-c1 complex subunit 7-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 55.7 | 19.6 | 24.7 | 2.2550607 | 0.79352224 |
| Scape | 41.1 | 21.7 | 37.2 | 1.1048387 | 0.5833333 |
| Brain | 54.9 | 45.1 | 1.2172949 | ||
| Crop | 33 | 29.5 | 37.5 | 0.88 | 0.7866667 |
| Eye | 57 | 15.8 | 27.2 | 2.0955882 | 0.5808824 |
| Intestine | 62.2 | 13 | 24.8 | 2.5080645 | 0.5241935 |
| Leg, front | 82.1* | 17.9 | 4.586592 | ||
| Leg, middle | 79* | 21 | 3.7619047 | ||
| Leg, rear | 40.3 | 59.7 | 0.67504185 | ||
| Mandibular gland | 28.5 | 33.5 | 38 | 0.75 | 0.8815789 |
| Rectum | 70.6 | 29.4 | 2.4013605 | ||
| Salivary gland, cerebral | 18.4 | 42.6 | 39 | 0.47179487 | 1.0923077 |
| Salivary gland, thoracic | 29.9 | 40.9 | 29.3 | 1.0204778 | 1.3959044 |
| Sternite | 27.1 | 31.5 | 41.3 | 0.65617436 | 0.7627119 |
| Tergite | 22 | 29.7 | 48.3 | 0.45548654 | 0.61490685 |
| Ventriculus | 11.9 | 88.1 | 0.13507378 | ||
| Thoracic muscle | 9.3 | 78.4 | 12.3 | 0.75609756 | 6.373984 |
| Fat body | 28.5 | 54.6 | 16.9 | 1.6863905 | 3.2307692 |
| Malpighian tubules | 47.4 | 22.1 | 30.6 | 1.5490196 | 0.7222222 |
| Nerve chord | 50.8 | 14.6 | 34.6 | 1.4682081 | 0.42196533 |
| Poison sac | |||||
| Sting | 48.1 | 51.9 | 0.92678225 | ||
| Heart | 48.3 | 20.5 | 31.2 | 1.5480769 | 0.65705127 |
| Hypopharyngeal gland | 93.6 | 6.4 | 14.625 | ||
| Galea | 31.5 | 28.2 | 40.3 | 0.7816377 | 0.69975185 |
| Glossa | 28.9 | 24.2 | 46.8 | 0.61752135 | 0.517094 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.8 | 38.4 | 35.2 | 1.1022727 | 1.0909091 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MATYLTNYLLRKFPNLQKWAYEAAGFNQYGLHRDDILHETEEVREALKRVPPHIVEERDF RIIRAMQLDCQKKILPKEQWTKFEDDILYLTPIIEEMRKEREEKERWNAE |
 Top
| |