| Protein: 295849268 NP_001171498.1 superoxide dismutase 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.1 | 32.3 | 30.6 | 1.2124183 | 1.0555556 |
| Scape | 26.8 | 35.9 | 37.3 | 0.71849865 | 0.9624665 |
| Brain | 32.7 | 37.8 | 29.6 | 1.1047298 | 1.277027 |
| Crop | 41.6 | 18.4 | 40 | 1.04 | 0.46 |
| Eye | 27.2 | 39.5 | 33.3 | 0.8168168 | 1.1861862 |
| Intestine | 30.8 | 46.4 | 22.8 | 1.3508772 | 2.0350878 |
| Leg, front | 31.8 | 36.2 | 32 | 0.99375 | 1.13125 |
| Leg, middle | 30.5 | 36.7 | 32.8 | 0.92987806 | 1.1189024 |
| Leg, rear | 39.8 | 34.3 | 25.9 | 1.5366795 | 1.3243244 |
| Mandibular gland | 4.8 | 62.6 | 32.6 | 0.14723927 | 1.9202454 |
| Rectum | 19 | 15.1 | 65.9 | 0.28831562 | 0.22913505 |
| Salivary gland, cerebral | 71.7 | 13.3 | 15 | 4.78 | 0.88666666 |
| Salivary gland, thoracic | 46.6 | 19.4 | 33.9 | 1.3746313 | 0.5722714 |
| Sternite | 16.8 | 30 | 53.2 | 0.31578946 | 0.56390977 |
| Tergite | 8.6 | 58.6 | 32.9 | 0.26139817 | 1.781155 |
| Ventriculus | 18.4 | 43.9 | 37.7 | 0.48806366 | 1.1644562 |
| Thoracic muscle | 19.2 | 52.6 | 28.2 | 0.68085104 | 1.8652482 |
| Fat body | 25.9 | 42.8 | 31.3 | 0.827476 | 1.3674121 |
| Malpighian tubules | 39.5 | 28.8 | 31.7 | 1.2460568 | 0.90851736 |
| Nerve chord | 27.6 | 39.2 | 33.2 | 0.8313253 | 1.1807228 |
| Poison sac | 30.9 | 69.1 | 0.447178 | ||
| Sting | 40.7 | 59.3 | 0.68634063 | ||
| Heart | 20.5 | 42.7 | 36.7 | 0.5585831 | 1.1634878 |
| Hypopharyngeal gland | 72.6 | 27.4 | 2.649635 | ||
| Galea | 22.9 | 36.1 | 41.1 | 0.5571776 | 0.8783455 |
| Glossa | 30.6 | 40.9 | 28.4 | 1.0774648 | 1.4401408 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.1 | 38 | 36.2 | 0.8038674 | 1.0497237 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTKAVCVLQGEVKGTIFFEQPESTNSVKVTGQVTGLKKGLHGFHVHEFGDNTNGCTSAGA HFNPLGKDHGGPDSDIRHVGDLGNIEADASGVANVNITDKTIQLQGPHSVIGRTLVVHAD PDDLGKGGVELSKTTGNAGARLACGVIGITKV |
 Top
| |