| Protein: 328782269 XP_001121953.2 PREDICTED: hypothetical protein LOC726199 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 46.9 | 33.7 | 19.4 | 2.4175258 | 1.7371134 |
| Scape | 42.9 | 28.3 | 28.8 | 1.4895834 | 0.9826389 |
| Brain | |||||
| Crop | 34.4 | 27.3 | 38.3 | 0.8981723 | 0.7127937 |
| Eye | 68.2 | 10.7 | 21.1 | 3.2322276 | 0.507109 |
| Intestine | 13.4 | 57.1 | 29.5 | 0.45423728 | 1.9355932 |
| Leg, front | 30.5 | 37.4 | 32.1 | 0.95015574 | 1.165109 |
| Leg, middle | 30.5 | 35.4 | 34.1 | 0.89442813 | 1.0381231 |
| Leg, rear | 33.9 | 39.9 | 26.2 | 1.2938931 | 1.5229008 |
| Mandibular gland | 19.9 | 80.1 | 0.24843945 | ||
| Rectum | |||||
| Salivary gland, cerebral | 40.9 | 20.4 | 38.6 | 1.0595855 | 0.5284974 |
| Salivary gland, thoracic | 40.1 | 25 | 34.9 | 1.1489972 | 0.7163324 |
| Sternite | 13.3 | 41.2 | 45.4 | 0.29295155 | 0.907489 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 46.7 | 53.3 | 0.8761726 | ||
| Fat body | 25.6 | 49.7 | 24.7 | 1.0364373 | 2.0121458 |
| Malpighian tubules | 36.4 | 26.8 | 36.9 | 0.98644984 | 0.72628725 |
| Nerve chord | 36.3 | 24.8 | 38.8 | 0.935567 | 0.63917524 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | 19 | 81 | 0.2345679 | ||
| Galea | 36.8 | 34.6 | 28.6 | 1.2867132 | 1.2097902 |
| Glossa | 40.6 | 28 | 31.5 | 1.2888889 | 0.8888889 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.4 | 31.7 | 38.1 | 0.92913383 | 0.832021 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKTDMPDIKQGEVKIENRREPSKQGSRSRVCQEHDEQDCLSENEHEFESLEYEEDVYYSN LTATPSFDDIDELSDDVDEIVVHCWRDSNGDIDEIVVDDANLSVETQFLTNDAEDGATNR DQKKKKKSVRVIFQDFSKPYLAKISNSQNYKKFLELVKGEDASLHSAGYISPTSDNVVNE LQGLSLEEQNRQKAEWSAELAKVEEEIQTLRHVLANKIRVSQDLKRKLGISVWKEITDDM NQGLKNVKESQVYQNVGEKLGQITKAVTDNSLFQKTESVFKTTAEKTTSILGGFGSGLSM KLGQMRNSDSFRSLEERVGSAYENMKTKVVPSRSNSMQSFNEMLRDTDSLRSAPTATSPT IPEDKLLS |
 Top
| |