Home List proteins by tissue Protein search Downloads Links
Protein: 328786642 XP_001120125.2 PREDICTED: fumarate hydratase mitochondrial-like
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 32.7 35.7 31.7 1.0315458 1.1261829
Scape 24.9 31.2 44 0.5659091 0.7090909
Brain 47.3 22.3 30.4 1.5559211 0.73355263
Crop 29.4 28 42.6 0.69014084 0.657277
Eye 36 45.7 18.3 1.9672132 2.4972677
Intestine 25.6 33.9 40.5 0.6320988 0.837037
Leg, front 29.8 29.5 40.8 0.73039216 0.7230392
Leg, middle 30.1 31.1 38.8 0.77577317 0.8015464
Leg, rear 20.1 32.4 47.5 0.4231579 0.68210524
Mandibular gland 82.6 17.4 4.7471266
Rectum 32.4 43.2 24.4 1.3278688 1.7704918
Salivary gland, cerebral 33 27 40.1 0.8229426 0.6733167
Salivary gland, thoracic 26.1 43.3 30.5 0.8557377 1.4196721
Sternite 47.9 41.6 10.6 4.518868 3.9245284
Tergite 54.4 24.8 20.8 2.6153846 1.1923077
Ventriculus
Thoracic muscle 7.8 59.6 32.6 0.2392638 1.8282208
Fat body 36.6 40.4 23 1.5913043 1.7565217
Malpighian tubules 34.9 36.3 28.8 1.2118056 1.2604166
Nerve chord 29.5 38.9 31.5 0.93650794 1.2349206
Poison sac
Sting 42.1 57.9 0.7271157
Heart 45.6 18.7 35.7 1.277311 0.52380955
Hypopharyngeal gland 84.4 15.6 5.4102564
Galea 22.1 39.4 38.5 0.574026 1.0233766
Glossa 19.7 25.8 54.5 0.3614679 0.47339448
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 34 37.2 33.2 1.0240964 1.120482
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MMLNLLKYLSNNHGLLELKKSSSFLTLRLSLNTTAVVSKGKKKESDSEFRIERDTFGEVK
VPVNKYYGAQTVRSMQNFPIGDTFERMPYGVIVAYGILKKAAAETNKELGMDAKVADAIS
QAADDVICGDLYNDHFPLVIWQTGSGTQTNMNVNEVISNRAIELLGGKLGSKTPVHPNDH
VNKSQSTNDSFPTVMQVALALEINRVLLPGLEKLHNALNEKVNAWKHIIKIGRTHTQDAV
PLTLGQEFSGYAQQICNGIQRVKDTLPRLYQLALGGTAVGTGLNAPKGFAEKAIAKIADI
TGLPFVPVANKFEALASRDTIVETHGAFNTVAVSLMKIANDIRFLGSGPRCGLGELSLPE
NEPGSSIMPGKVNPTQCEALSMVCCQVMGNHTAITVAGSNGHFELNVFIPVMISNALRSA
RLLGDASASFTKXQFDEWVKPEEMIGPK

Top