| Protein: 58531215 NP_001010975.1 ADP/ATP translocase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.3 | 27.3 | 42.5 | 0.71294117 | 0.64235294 |
| Scape | 32.2 | 25.1 | 42.6 | 0.75586855 | 0.58920187 |
| Brain | 23 | 31.5 | 45.5 | 0.5054945 | 0.6923077 |
| Crop | 35.3 | 41.4 | 23.3 | 1.5150214 | 1.776824 |
| Eye | 44.7 | 13.2* | 42.1 | 1.0617577 | 0.31353918 |
| Intestine | 28.2 | 28.4 | 43.4 | 0.6497696 | 0.6543779 |
| Leg, front | 24.6 | 27 | 48.4 | 0.5082645 | 0.55785125 |
| Leg, middle | 27.4 | 32.6 | 40 | 0.685 | 0.815 |
| Leg, rear | 31.2 | 43.5 | 25.3 | 1.2332016 | 1.7193676 |
| Mandibular gland | 62.4 | 13.5 | 24.2 | 2.5785124 | 0.55785125 |
| Rectum | 18.4 | 53.8 | 27.8 | 0.6618705 | 1.9352518 |
| Salivary gland, cerebral | 31.3 | 25 | 43.7 | 0.71624714 | 0.5720824 |
| Salivary gland, thoracic | 33.7 | 31 | 35.3 | 0.95467424 | 0.87818694 |
| Sternite | 27.4 | 27.9 | 44.8 | 0.61160713 | 0.62276787 |
| Tergite | 35.4 | 31.3 | 33.3 | 1.063063 | 0.9399399 |
| Ventriculus | 64.7 | 35.3 | 1.8328612 | ||
| Thoracic muscle | 13.9 | 70.2 | 15.9 | 0.8742138 | 4.4150944 |
| Fat body | 29.3 | 46.3 | 24.4 | 1.2008197 | 1.8975409 |
| Malpighian tubules | 38.5 | 29.5 | 32 | 1.203125 | 0.921875 |
| Nerve chord | 22.1 | 44.1 | 33.8 | 0.65384614 | 1.3047338 |
| Poison sac | 80.1 | 19.9 | 4.0251255 | ||
| Sting | 51.4 | 48.6 | 1.0576131 | ||
| Heart | 29.9 | 38.4 | 31.7 | 0.9432177 | 1.2113565 |
| Hypopharyngeal gland | 55.8 | 44.2 | 1.2624434 | ||
| Galea | 40.3 | 32.6 | 27.1 | 1.4870849 | 1.202952 |
| Glossa | 45.7 | 23.9 | 30.4 | 1.5032895 | 0.7861842 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.1 | 38.1 | 34.8 | 0.92241377 | 1.0948275 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSGLADPVAFAKDFLAGGVAAAISKTTVAPIERVKLLLQVQHISKQISEEQRYKGMIDCF VRIPKEQGFLSYWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFLRYFVGNLA SGGAAGATSLCFVYPLDFARTRLAADVGKAGGEREFTGLGNCLTKIFKADGITGLYRGFG VSVQGIIIYRAAYFGFYDTARGMLPDPKKTPFLISWGIAQVVTTVAGIVSYPFDTVRRRM MMQSGRAKSEILYKSTLHCWATIYKTEGGNAFFKGAFSNILRGTGGALVLVLYDEIKNLL |
 Top
| |