| Protein: 328793182 XP_001123307.2 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.5 | 55.5 | 0.8018018 | ||
| Scape | 48.1 | 18.5 | 33.4 | 1.4401197 | 0.5538922 |
| Brain | 52.5 | 47.5 | 1.1052631 | ||
| Crop | 18.9 | 46.2 | 34.9 | 0.5415473 | 1.3237822 |
| Eye | 42.5 | 57.5 | 0.73913044 | ||
| Intestine | 41.1 | 58.9 | 0.6977929 | ||
| Leg, front | 9.9* | 44.4 | 45.7 | 0.21663019 | 0.9715536 |
| Leg, middle | 46.4 | 28.9 | 24.7 | 1.8785425 | 1.1700405 |
| Leg, rear | 16.6 | 24 | 59.5 | 0.2789916 | 0.40336135 |
| Mandibular gland | 79.7 | 20.3 | 3.9261084 | ||
| Rectum | |||||
| Salivary gland, cerebral | 26.8 | 11.7 | 61.5 | 0.43577236 | 0.1902439 |
| Salivary gland, thoracic | 25.9 | 46.8 | 27.3 | 0.94871795 | 1.7142857 |
| Sternite | 35 | 28.9 | 36.1 | 0.9695291 | 0.80055404 |
| Tergite | 28.4 | 27.2 | 44.3 | 0.64108354 | 0.6139955 |
| Ventriculus | |||||
| Thoracic muscle | 26.7 | 46.5 | 26.8 | 0.99626863 | 1.7350746 |
| Fat body | 33 | 47.6 | 19.5 | 1.6923077 | 2.4410257 |
| Malpighian tubules | 41 | 26.5 | 32.5 | 1.2615385 | 0.8153846 |
| Nerve chord | 53.6 | 15.4 | 30.9 | 1.7346278 | 0.49838188 |
| Poison sac | |||||
| Sting | 30.3 | 69.7 | 0.43472022 | ||
| Heart | 51.6 | 14.7 | 33.6 | 1.5357143 | 0.4375 |
| Hypopharyngeal gland | 89.5 | 10.5 | 8.523809 | ||
| Galea | 73.3* | 26.7 | 2.7453184 | ||
| Glossa | 55.7 | 7.5 | 36.7 | 1.5177112 | 0.20435968 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.7 | 34.5 | 38.9 | 1.0205655 | 0.88688946 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALRVLSLLYINRTFTRYGLTKRFFANTNKETEQDSEIIVRKIKTDLVSKEEKLAREARK EAVIIVSDAEDVGICSGVPEEHIKSRTVRIYCPAKNAMQSGTNNINHWQIDFDTRERWEN PLMGWTSTGDPLSNLHVTFATKEEAIAHCNKMRWKYYIQNPNINNPKPRSYGTNFSWNKR TRVSTK |
 Top
| |