| Protein: 328775991 XP_623800.2 PREDICTED: succinyl-CoA ligase [GDP-forming] subunit alpha mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.6 | 30.3 | 39 | 0.7846154 | 0.77692306 |
| Scape | 24.5 | 31.4 | 44.1 | 0.5555556 | 0.71201813 |
| Brain | 26 | 74 | 0.35135135 | ||
| Crop | 10.4 | 53.9 | 35.7 | 0.29131654 | 1.5098039 |
| Eye | 67.3 | 32.7 | 2.058104 | ||
| Intestine | 24.8 | 25.1 | 50.1 | 0.49501 | 0.500998 |
| Leg, front | 32.7 | 29.1 | 38.2 | 0.8560209 | 0.7617801 |
| Leg, middle | 31.8 | 27.5 | 40.7 | 0.7813268 | 0.6756757 |
| Leg, rear | 27.4 | 29.3 | 43.3 | 0.63279444 | 0.67667437 |
| Mandibular gland | 37.2 | 62.8 | 0.5923567 | ||
| Rectum | |||||
| Salivary gland, cerebral | 58.6 | 9.9 | 31.5 | 1.8603175 | 0.31428573 |
| Salivary gland, thoracic | 43.1 | 26.9 | 30 | 1.4366666 | 0.89666665 |
| Sternite | 44.9 | 46.3* | 8.7 | 5.1609197 | 5.321839 |
| Tergite | 69.2 | 15.8 | 15 | 4.613333 | 1.0533333 |
| Ventriculus | |||||
| Thoracic muscle | 7.3 | 55.5 | 37.2 | 0.19623657 | 1.4919355 |
| Fat body | 39.6 | 33.6 | 26.8 | 1.4776119 | 1.2537314 |
| Malpighian tubules | 34.3 | 33.9 | 31.8 | 1.0786164 | 1.0660378 |
| Nerve chord | 28.4 | 30.9 | 40.7 | 0.6977887 | 0.75921375 |
| Poison sac | |||||
| Sting | 46.2 | 53.8 | 0.85873604 | ||
| Heart | 38.2 | 25.4 | 36.4 | 1.0494505 | 0.6978022 |
| Hypopharyngeal gland | 80.9 | 19.1 | 4.235602 | ||
| Galea | 41.8 | 3.8* | 54.4 | 0.7683824 | 0.06985294 |
| Glossa | 43.5 | 23.7 | 32.7 | 1.3302752 | 0.72477067 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.8 | 32.6 | 38.2 | 0.9633508 | 0.85340315 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAVAVRTLSKFTVRKCGNLLRTQIRFNYVDTRKNLKIDSNTKVICQGFTGKQGTFHCQQA IEYGTKIVGGVNPKKAGTQHLGKPVFKNVKEAKEATGATASVIYVPPPSAAAAIMEAIDA EMPLIVCITEGIPQHDMVKVKRRLLEQNKSRLVGPNCPGIIAPEQCKIGIMPGHIHQKGK IGIVSRSGTLTYEAVNQTTLAGLGQTLCIGIGGDPFNGTNFIDCLDVFLRDPECDGIIMI GEIGGSAEESAAEYLIEHNTVGCSSKLGNKTKPVVSFIAGITAPPGRRMGHAGAIISGGK GGAQDKINALEKAGVIVSRSPAQMGNELLKEMTRLGLICN |
 Top
| |