| Protein: 328776580 XP_625056.3 PREDICTED: enolase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.7 | 46 | 27.3 | 0.978022 | 1.6849817 |
| Scape | 19.9 | 45.4 | 34.7 | 0.57348704 | 1.3083574 |
| Brain | 27.7 | 36.1 | 36.2 | 0.76519334 | 0.99723756 |
| Crop | 50.3 | 16.2 | 33.5 | 1.5014925 | 0.48358208 |
| Eye | 26.7 | 37.7 | 35.6 | 0.75 | 1.0589888 |
| Intestine | 33.5 | 32.5 | 34 | 0.9852941 | 0.9558824 |
| Leg, front | 31.8 | 34.5 | 33.7 | 0.9436202 | 1.0237389 |
| Leg, middle | 32.9 | 30.7 | 36.5 | 0.90136987 | 0.84109586 |
| Leg, rear | 31.5 | 35.7 | 32.8 | 0.96036583 | 1.0884147 |
| Mandibular gland | 10.7 | 43.2 | 46.1 | 0.23210412 | 0.93709326 |
| Rectum | 20.9 | 38.6 | 40.5 | 0.5160494 | 0.95308644 |
| Salivary gland, cerebral | 34 | 29.7 | 36.3 | 0.93663913 | 0.8181818 |
| Salivary gland, thoracic | 31.5 | 36.3 | 32.2 | 0.9782609 | 1.1273292 |
| Sternite | 34.9 | 35.4 | 29.7 | 1.1750842 | 1.1919192 |
| Tergite | 32.3 | 39.1 | 28.6 | 1.1293706 | 1.3671329 |
| Ventriculus | 19.4 | 36.6 | 44 | 0.4409091 | 0.83181816 |
| Thoracic muscle | 36.4 | 51.8 | 11.8 | 3.0847456 | 4.3898306 |
| Fat body | 51.4 | 27.1 | 21.6 | 2.3796296 | 1.2546296 |
| Malpighian tubules | 31.3 | 34.5 | 34.2 | 0.9152047 | 1.0087719 |
| Nerve chord | 25 | 42.9 | 32.1 | 0.7788162 | 1.3364486 |
| Poison sac | |||||
| Sting | 42.7 | 57.3 | 0.7452007 | ||
| Heart | 40.9 | 25 | 34.1 | 1.1994135 | 0.73313785 |
| Hypopharyngeal gland | 57 | 43 | 1.3255814 | ||
| Galea | 27 | 48 | 25.1 | 1.0756972 | 1.9123507 |
| Glossa | 25.8 | 43.9 | 30.2 | 0.8543046 | 1.4536424 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.5 | 37.9 | 34 | 0.89705884 | 1.1147059 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIKFLISKYSTRSTTSSTTTSSTTSFTRTSSRMSSIKSIKARQIFDSRGNPTVEVDLVTD DGLFRSEVPSGASTGIHEALELRDNDKSKYHGKSVFKAISNINNTIGPELIKSNLDVTSQ SDIDNFLLKLDGTPNKSNLGANAILGVSLAVCKAGAAKKKKPLYRYIADLAGNTNIILPV PAFNVINGGSHAGNKLAMQEFMILPTGASSFSDAMKMGTEIYHHLKNGIKSRFGLDATSV GDEGGFAPNILDNKEALNLIIDSIKTAGYDGKVKIGMDVAASEFYKNGKYDLNFKNEKSD PSTYLDSDSLKNLYLQFIKEFPIVSIEDPFDQDDWSSWTTLTSSTDIQIVGDDVTVTNPN R |
 Top
| |