| Protein: 110751008 XP_001122467.1 PREDICTED: cytochrome b-c1 complex subunit 8-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.5 | 35.3 | 32.1 | 1.0124611 | 1.0996885 |
| Scape | 49.1 | 19.4 | 31.5 | 1.5587301 | 0.61587304 |
| Brain | 29.4 | 28.9 | 41.7 | 0.705036 | 0.69304556 |
| Crop | 22.9 | 41.9 | 35.2 | 0.6505682 | 1.1903409 |
| Eye | 31.4 | 23.3 | 45.3 | 0.6931567 | 0.5143488 |
| Intestine | 36.2 | 29.2 | 34.5 | 1.0492754 | 0.84637684 |
| Leg, front | 26.1 | 41.8 | 32.2 | 0.81055903 | 1.2981366 |
| Leg, middle | 30.7 | 41.2 | 28.2 | 1.0886525 | 1.4609929 |
| Leg, rear | 15 | 27.7 | 57.2 | 0.26223776 | 0.48426574 |
| Mandibular gland | 21.5 | 56.4 | 22.1 | 0.9728507 | 2.5520363 |
| Rectum | |||||
| Salivary gland, cerebral | 6.7 | 50.5 | 42.7 | 0.15690866 | 1.1826698 |
| Salivary gland, thoracic | 21.2 | 52.4 | 26.4 | 0.8030303 | 1.9848485 |
| Sternite | 30 | 39.3 | 30.7 | 0.9771987 | 1.2801303 |
| Tergite | 26.2 | 32.4 | 41.4 | 0.6328502 | 0.7826087 |
| Ventriculus | |||||
| Thoracic muscle | 8.6 | 75.4 | 15.9 | 0.5408805 | 4.7421384 |
| Fat body | 41 | 46.8* | 12.2 | 3.3606558 | 3.8360655 |
| Malpighian tubules | 41.2 | 27.9 | 30.9 | 1.3333334 | 0.9029126 |
| Nerve chord | 32.3 | 36.1 | 31.6 | 1.022152 | 1.142405 |
| Poison sac | |||||
| Sting | 59.8 | 40.2 | 1.4875622 | ||
| Heart | 43.4 | 22.8 | 33.9 | 1.280236 | 0.67256635 |
| Hypopharyngeal gland | 90.1 | 9.9 | 9.10101 | ||
| Galea | 33.3 | 38.4 | 28.3 | 1.1766784 | 1.3568904 |
| Glossa | 50.2 | 15.3 | 34.5 | 1.4550725 | 0.44347826 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30 | 40.5 | 32.1 | 0.93457943 | 1.2616823 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGLKFGNLKKLSGVTFFRLSPYEQRAFAGVGEATGKMLKRLRSTILTAGPFFLLSYVIME WATEENHKMHRKNPKDYENDV |
 Top
| |