| Protein: 328783479 XP_396249.3 PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.9 | 57.1 | 0.7513135 | ||
| Scape | 29.8 | 32 | 38.2 | 0.7801047 | 0.8376963 |
| Brain | |||||
| Crop | 42 | 58 | 0.7241379 | ||
| Eye | |||||
| Intestine | 44 | 29.5 | 26.6 | 1.6541353 | 1.1090225 |
| Leg, front | 34 | 30.3 | 35.8 | 0.9497207 | 0.84636873 |
| Leg, middle | 35.8 | 28.3 | 35.9 | 0.9972145 | 0.7883008 |
| Leg, rear | 61.4 | 19.9 | 18.7 | 3.2834225 | 1.0641711 |
| Mandibular gland | |||||
| Rectum | 63.2 | 36.8 | 1.7173913 | ||
| Salivary gland, cerebral | 79.9 | 2.3 | 17.8 | 4.488764 | 0.12921348 |
| Salivary gland, thoracic | 9.9* | 53.7 | 36.3 | 0.27272728 | 1.4793389 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 0.1* | 73 | 26.9 | 0.003717472 | 2.7137547 |
| Thoracic muscle | |||||
| Fat body | 13.1 | 62.2 | 24.7 | 0.5303644 | 2.5182185 |
| Malpighian tubules | 34.3 | 34 | 31.7 | 1.082019 | 1.0725552 |
| Nerve chord | 15 | 53.7 | 31.3 | 0.47923324 | 1.715655 |
| Poison sac | |||||
| Sting | 40.5 | 59.5 | 0.6806723 | ||
| Heart | 26.4 | 40.7 | 32.9 | 0.8024316 | 1.2370821 |
| Hypopharyngeal gland | 84.2 | 15.8 | 5.329114 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35 | 41.8 | 34.4 | 1.0174419 | 1.2151163 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIKNSALKLNCVGGNSINTLKYLSTQTSGGVPHKSAIAGKEAQQTNIENDVLFKEVGNKG IIILNRPKALNALNLSMVEKIYPVLKKWESSKKLVIIEGAGDKAFCAGGDIKSIGIEIKN TGNKALAEIFLKKEYTLNHLIGTYKIPYIATINGITMGGGVGISVHGKYRIATEKTLFAM PETAVGLIPDVGGSYFLPRLKGKLGLYLGLTGDRLQGIDVLLAGIATHFVPSEKLPNLKE DLLMTDKSDIKEILNKYQSKTLNQEFCLAPYMSKIDKYFSASCIEEIIERLKEDNSEWAK KTLQMLLKASPTALKFTMCSIQKGSTLNLADCLKMEFRLMCNFFNKNSDFCEGVRAVLID KDRKPKWNPKNLIEVKDNYINQQFNLLTNELHSIKLDYDVREIA |
 Top
| |