| Protein: 328781096 XP_394922.3 PREDICTED: juvenile hormone epoxide hydrolase 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.5 | 39.2 | 34.2 | 0.7748538 | 1.1461989 |
| Scape | 39.7 | 28.1 | 32.2 | 1.2329192 | 0.8726708 |
| Brain | 74.8* | 25.2 | 2.9682539 | ||
| Crop | 33.9 | 45.1 | 21 | 1.6142857 | 2.147619 |
| Eye | 3.3 | 77.3* | 19.4 | 0.17010309 | 3.9845362 |
| Intestine | 27.9 | 52.1 | 19.9 | 1.4020101 | 2.6180904 |
| Leg, front | 29.8 | 35.6 | 34.6 | 0.8612717 | 1.0289017 |
| Leg, middle | 29.2 | 33.3 | 37.5 | 0.7786667 | 0.888 |
| Leg, rear | 24.2 | 35.5 | 40.3 | 0.6004963 | 0.8808933 |
| Mandibular gland | 31.1 | 34.3 | 34.6 | 0.89884394 | 0.9913295 |
| Rectum | 16.1 | 42.1 | 41.8 | 0.38516745 | 1.007177 |
| Salivary gland, cerebral | 11.1 | 87.3* | 1.6 | 6.9375 | 54.5625 |
| Salivary gland, thoracic | 13.8* | 57.1 | 29.2 | 0.47260275 | 1.9554795 |
| Sternite | 8.4 | 44.2 | 47.4 | 0.17721519 | 0.93248945 |
| Tergite | 2.6 | 80 | 17.4 | 0.14942528 | 4.597701 |
| Ventriculus | 39.3 | 60.7 | 0.64744645 | ||
| Thoracic muscle | |||||
| Fat body | 8.2 | 36.8 | 55 | 0.14909092 | 0.6690909 |
| Malpighian tubules | 53.3 | 15.2 | 31.5 | 1.6920635 | 0.48253968 |
| Nerve chord | 0.7* | 86.1* | 13.3 | 0.05263158 | 6.4736843 |
| Poison sac | 36.6 | 63.4 | 0.5772871 | ||
| Sting | 25.7 | 74.3 | 0.34589502 | ||
| Heart | 1.4* | 68.6 | 30 | 0.046666667 | 2.2866666 |
| Hypopharyngeal gland | 71.7 | 28.3 | 2.5335689 | ||
| Galea | 29 | 16.1 | 55 | 0.5272727 | 0.29272726 |
| Glossa | 43.8 | 28.6 | 27.7 | 1.5812274 | 1.032491 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 22.5 | 48 | 35 | 0.64285713 | 1.3714286 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MWKTVGMLGLCVAGISIYLSSVNELNVPTLPETNWGSKKNEKESIEIRPFKIDVSKSVLD DLKYRLAHRRTFKKPLENVGWTYGISTTYLNTVLDYWRDKYNWTERQALLNKYPQFMTTI QGLDIHFYHVKPNLPNNKNLKVLPLLMLHGWPGSVVEFQKIIPMLTKPWPNQNFVFEVIV PSLPGYGFSEGAVRPGMANAQIAVIFKNLMQRLGFEKFYVQGGDWGSVIASDMAVLFPEK IIGLHNNMCTSLNLSNLFWLFVGTYFPSLIGANEHYSKFFPVSEILSFLIEESGYFHIQA TKPDTIGAALTASPDALAAYILEKFSVWTNKTYKKQDDGGITEKFVLDELLDNIMIYWIT NSITTSVRLYAENYTSSYRSLKIDQLPIKVFTACAVFPNEILVLPESLLKQKYPNIIQYN IISRGGHFAAFEEPRLLADDIFSFVKKIENLTSKSS |
 Top
| |