| Protein: 328789465 XP_003251278.1 PREDICTED: membrane-associated progesterone receptor component 2-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 45.1 | 27 | 27.9 | 1.6164875 | 0.9677419 |
| Scape | 39.5 | 32.4 | 28.1 | 1.405694 | 1.1530249 |
| Brain | |||||
| Crop | 36.8 | 32 | 31.3 | 1.1757189 | 1.0223643 |
| Eye | 53.2 | 25 | 21.8 | 2.440367 | 1.146789 |
| Intestine | 29.4 | 41.2 | 29.4 | 1 | 1.4013605 |
| Leg, front | 39.1 | 27.5 | 33.4 | 1.1706587 | 0.8233533 |
| Leg, middle | 31.2 | 25.5 | 43.3 | 0.7205543 | 0.5889146 |
| Leg, rear | 44.6 | 25.8 | 29.6 | 1.5067568 | 0.8716216 |
| Mandibular gland | 8.7 | 10.4 | 81 | 0.10740741 | 0.12839507 |
| Rectum | 35.2 | 4.3 | 60.4 | 0.58278143 | 0.071192056 |
| Salivary gland, cerebral | 63.2 | 16.4 | 20.4 | 3.0980392 | 0.8039216 |
| Salivary gland, thoracic | 37 | 26.2 | 36.8 | 1.0054348 | 0.7119565 |
| Sternite | 8.4 | 27.2 | 64.4 | 0.13043478 | 0.42236024 |
| Tergite | 6.9 | 52 | 41.2 | 0.16747573 | 1.2621359 |
| Ventriculus | 7.7 | 92.3 | 0.08342362 | ||
| Thoracic muscle | |||||
| Fat body | 12.6 | 34.2 | 53.2 | 0.23684211 | 0.64285713 |
| Malpighian tubules | 37.4 | 26.3 | 36.3 | 1.030303 | 0.7245179 |
| Nerve chord | 27.7 | 37.5 | 34.9 | 0.7936963 | 1.0744985 |
| Poison sac | |||||
| Sting | 29.1 | 70.9 | 0.41043723 | ||
| Heart | 17.5 | 43.7 | 38.7 | 0.4521964 | 1.1291989 |
| Hypopharyngeal gland | 58 | 42 | 1.3809524 | ||
| Galea | 38.9 | 23.7 | 37.5 | 1.0373334 | 0.632 |
| Glossa | 46.8 | 27.7 | 25.5 | 1.8352941 | 1.0862745 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.7 | 29.7 | 42.6 | 0.74413145 | 0.6971831 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAEKNDSPGSTSTSTGHESQPLLSSFITEIVKSPINLVLVGVIALLVYKIVKSKTKIEEP VKEIKKLPQLRRDFTLEELKKYNGKGPDGRILIAINGSVYDCTRGAHFYGPGAPYEVFGG KDISRALAKFSLETSQEYDDLSDLKTGEMESIREWEEQFKEKYDYVGRLLKPGEAPTNYS DEEDEGSQLENETKSKND |
 Top
| |