| Protein: 328783370 XP_001121121.2 PREDICTED: trypsin-1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 93.5* | 6.5 | 14.384615 | ||
| Eye | |||||
| Intestine | 98.2* | 1.8 | 54.555557 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 96.5* | 3.5 | 27.571428 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 99.3* | 0.7 | 141.85715 | ||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 84.9* | 15.1 | 5.6225166 | ||
| Nerve chord | 93.4* | 6.6 | 14.151515 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 93.2 | 95.4 | 5.7 | 16.350878 | 16.736841 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
METIVRLSQGKVEKKLSTMSNLVALLALMASLAAGNPADRLDMVQRMDGRIVGGEATTIH EAPYQISLQKDGYHICGGSIISANWVLTAGHCSSYPPSTYKIRSGSTNVYSGGSLHDVER IIRHKKYTTNQNGIPSNDIALFRIKDTFEFDESTKPVQLYQGDSASLVGKYGLVTGWGLT NIKIPPLLHKVSVPLVSKRECDRDYSRFGGVPQGELCAGYPEGGKDSCQGDSGGPLVVDG NLVGVVSWGMGCGTPKYPGVYTDVAYYREWVRENSEV |
 Top
| |