![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328784314 XP_003250432.1 PREDICTED: LOW QUALITY PROTEIN: adipocyte plasma membrane-associated protein |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.5 | 27.5 | 35 | 1.0714285 | 0.78571427 |
| Scape | 33.7 | 32.5 | 33.8 | 0.9970414 | 0.96153843 |
| Brain | 49.8 | 50.2 | 0.9920319 | ||
| Crop | 49.6 | 24.4 | 26 | 1.9076923 | 0.93846154 |
| Eye | 64.2 | 35.8 | 1.7932961 | ||
| Intestine | 19.9 | 55.3 | 24.8 | 0.80241936 | 2.2298386 |
| Leg, front | 28.8 | 41.1 | 30.1 | 0.95681065 | 1.3654485 |
| Leg, middle | 29.5 | 37.4 | 33 | 0.8939394 | 1.1333333 |
| Leg, rear | 52.8 | 28.5 | 18.7 | 2.8235295 | 1.5240642 |
| Mandibular gland | 3.7 | 58.2 | 38.1 | 0.097112864 | 1.527559 |
| Rectum | 9.6 | 66.6 | 23.7 | 0.4050633 | 2.8101265 |
| Salivary gland, cerebral | 30.7 | 59.1* | 10.3 | 2.9805825 | 5.737864 |
| Salivary gland, thoracic | 28.3 | 37.9 | 33.9 | 0.83480823 | 1.1179941 |
| Sternite | 8.8 | 26.3 | 64.9 | 0.13559322 | 0.40523884 |
| Tergite | 7.6 | 53.4 | 39 | 0.1948718 | 1.3692307 |
| Ventriculus | 18.6 | 15.3 | 66.1 | 0.28139183 | 0.23146747 |
| Thoracic muscle | |||||
| Fat body | 12.9 | 27.5 | 59.6 | 0.21644296 | 0.4614094 |
| Malpighian tubules | 30.4 | 40.2 | 29.4 | 1.0340136 | 1.3673469 |
| Nerve chord | 15.6 | 53.8 | 30.5 | 0.5114754 | 1.7639344 |
| Poison sac | 28.5 | 71.5 | 0.3986014 | ||
| Sting | 41.8 | 58.2 | 0.7182131 | ||
| Heart | 4.2 | 55.8 | 40 | 0.105 | 1.395 |
| Hypopharyngeal gland | 27.2 | 72.8 | 0.37362638 | ||
| Galea | 34.8 | 26.9 | 38.3 | 0.9086162 | 0.70234984 |
| Glossa | 30.4 | 33 | 36.6 | 0.8306011 | 0.90163934 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 24.4 | 40.5 | 40 | 0.61 | 1.0125 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGYLKSIGTVIIYIGFFLTVITFLPGIPPEVEVSEYSIKYPNTQTEFKSRLEEIQILFSG EVNGPEDFASFNGKIYTGIHGGYVVQIEENLIKPLVKFGQKCDGLWQEEKCGRPLGLKFN DKGELFVNDAYYGIFKVNINTREYINIVNSSEPIDGKIPKIINSLDIAKNGDIYWTDSST DFYLYDGMYSILANPSGRLIRYNAATKKNEVLLKNLGFANGVILSDDESFVIVSETTNSR IIKYNLKGSKAGQQEIFAEGLPGVPDNINSDKQGGFLVSLIILIDSNNPYLIQSLIPHPY IRKMLLRLFYLIEAPFKLLXDIYPNYYSERILHALGSLNIAKCIQPNRTSVILRMDKTGK ILDTLLMKNVSDISSAYIYNGYLWLGSPWNEYIIRVSLKQVFPDLADNNMKSLDTKEEKQ EKPFLTVSATPNVKIEAKSTKVTAKQEEVIKSSLKSTIKAQTTQKSNSDATIPKSTTPKS INQQSSSVSSKTSSSSSSKTSKEVMKDNLKIEKDDSKEIKKDNFNSQIKSETLKKASNEI KKDNSKTKHEIPNKNNEAKMKSNQPVKKDIYETQFGKSKLVKKDDNSNKK |
|
| |