| Protein: 66522386 XP_391961.2 PREDICTED: tropomyosin-1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 21.2 | 36.2 | 42.6 | 0.4976526 | 0.84976524 |
| Scape | 62.1* | 21.1 | 16.8 | 3.6964285 | 1.2559524 |
| Brain | |||||
| Crop | 30.9 | 7.8* | 61.3 | 0.5040783 | 0.12724307 |
| Eye | 1.1* | 40.4 | 58.5 | 0.01880342 | 0.6905983 |
| Intestine | 73.2* | 9.1 | 17.6 | 4.159091 | 0.51704544 |
| Leg, front | 47.8 | 22.8 | 29.4 | 1.6258503 | 0.7755102 |
| Leg, middle | 28.5 | 32.6 | 38.9 | 0.73264784 | 0.83804625 |
| Leg, rear | 33.5 | 46.8 | 19.7 | 1.7005076 | 2.3756344 |
| Mandibular gland | 31.2 | 1.5 | 67.3 | 0.46359584 | 0.022288263 |
| Rectum | 22.6 | 8.4 | 69 | 0.32753623 | 0.12173913 |
| Salivary gland, cerebral | 3.8* | 43 | 53.2 | 0.071428575 | 0.8082707 |
| Salivary gland, thoracic | 95.1* | 0.4* | 4.5 | 21.133333 | 0.08888889 |
| Sternite | 43.2 | 22.3 | 34.5 | 1.2521739 | 0.6463768 |
| Tergite | 42.1 | 13.2 | 44.7 | 0.94183445 | 0.295302 |
| Ventriculus | 32.7 | 14.7 | 52.6 | 0.621673 | 0.27946767 |
| Thoracic muscle | 45.9 | 54.1 | 0.84842885 | ||
| Fat body | 91.9* | 6.5* | 1.6 | 57.4375 | 4.0625 |
| Malpighian tubules | 56.9 | 12.3 | 30.8 | 1.8474026 | 0.39935064 |
| Nerve chord | 78.7* | 8.9 | 12.4 | 6.346774 | 0.7177419 |
| Poison sac | 66.6 | 33.4 | 1.994012 | ||
| Sting | 61.1 | 38.9 | 1.5706941 | ||
| Heart | 27.7 | 37 | 35.4 | 0.7824859 | 1.0451977 |
| Hypopharyngeal gland | 95.4 | 4.6 | 20.73913 | ||
| Galea | 27.9 | 35.4 | 36.6 | 0.76229507 | 0.9672131 |
| Glossa | 30.1 | 33.9 | 36 | 0.8361111 | 0.94166666 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.2 | 28.2 | 35.8 | 1.1787709 | 0.7877095 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDAIKKKMQAMKLEKDNAMDKADACEAQAKEANMRADKVNEEVGELQKKLAQVEGDLEAN KQNLEQANKDLEEKEKALTNAESEVAALNRKVQLIEEDLERSEERLNTATAKLAEASQAA DESSRMCKVLENRAQQDEERMDQLTNQLKEARLLAEDADGKSDEVSRKLAFVEDELEVAE DRVKSGEAKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKRQLKTLTVKLKEAEARAE FAEKTVKKLQKEVDRLEDELGINKDRYKSLADEMDSTFAELAGY |
 Top
| |