| Protein: 66519365 XP_623349.1 PREDICTED: annexin-B11-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 36.8 | 28.4 | 34.8 | 1.0574713 | 0.81609195 |
| Scape | 43 | 26.3 | 30.8 | 1.3961039 | 0.8538961 |
| Brain | 39.8 | 60.2 | 0.6611296 | ||
| Crop | 38.6 | 29.7 | 31.8 | 1.2138364 | 0.9339623 |
| Eye | 51.1 | 48.9 | 1.0449898 | ||
| Intestine | 28 | 34.2 | 37.8 | 0.7407407 | 0.9047619 |
| Leg, front | 37.7 | 33.5 | 28.8 | 1.3090278 | 1.1631944 |
| Leg, middle | 33.6 | 34.7 | 31.7 | 1.0599369 | 1.0946373 |
| Leg, rear | 41.3 | 28.7 | 30 | 1.3766667 | 0.95666665 |
| Mandibular gland | 24 | 76 | 0.31578946 | ||
| Rectum | 45.5 | 54.5 | 0.8348624 | ||
| Salivary gland, cerebral | 38.8 | 32.6 | 28.6 | 1.3566433 | 1.1398602 |
| Salivary gland, thoracic | 31.5 | 34.2 | 34.3 | 0.9183673 | 0.99708456 |
| Sternite | 38.2 | 31.6 | 30.1 | 1.2691029 | 1.0498339 |
| Tergite | 56.6 | 21.5 | 21.9 | 2.5844748 | 0.98173517 |
| Ventriculus | 29 | 30.8 | 40.2 | 0.72139305 | 0.76616913 |
| Thoracic muscle | |||||
| Fat body | 39.6 | 25.6 | 34.9 | 1.1346705 | 0.7335244 |
| Malpighian tubules | 23.9 | 36.8 | 39.3 | 0.6081425 | 0.93638676 |
| Nerve chord | 29 | 37.8 | 33.2 | 0.87349397 | 1.1385542 |
| Poison sac | |||||
| Sting | 40.6 | 59.4 | 0.68350166 | ||
| Heart | 28.9 | 32.8 | 38.3 | 0.7545692 | 0.85639685 |
| Hypopharyngeal gland | 63 | 37 | 1.7027028 | ||
| Galea | 43.1 | 20.4 | 36.5 | 1.1808219 | 0.5589041 |
| Glossa | 37.1 | 28.5 | 34.3 | 1.0816326 | 0.83090377 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.5 | 33.5 | 38.9 | 0.93830335 | 0.8611825 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSYGYQGPPPPVIPGNVKPPTSFGAPPGTPSAPGAPPYSQSGNIGFTNIPPVSFGMPQPY SSQVLTPYPTQPCHPIPNQYPQYPPPTPETPQMPFMQKSSYSPQMQQSYLNQSTIYPQQQ NYNYPNLQTMSDSKECFNTSSPYTFGPNVYSNNSSSYQGGSYPGGQGAGFYSPHKDRSYQ AHPAPAPRRNQFAPKLSPTVVSYNDFDARADAEILRKAMKGFGTDEKAIINVLANRSNLQ RQEIAVQFKTLYGKDLIKDLKSELSGNFEKLILAMMMPLPQFYAKELHDAMAGIGTDECV LIEVLCTMSNHEICVIKQAYEAMYGKTLEDDLRDDTSGNFKRLMVSLCCANRDESFDVNP ASAIEDAKELLRAGELRFGTDESVFNSILVQRNVPQLKQIFEEYENITGNNIETAIKNEF SGDIKKGLLAIVECVKDRAGFFAEQLYKSMKGLGTDDDRLIRLVVTRCEIDMGEIKEIFR QRYNESLEDFISGDCSGHYKKCLLALIS |
 Top
| |