| Protein: 48099074 XP_394859.1 PREDICTED: ester hydrolase C11orf54 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 68.3 | 31.7 | 2.1545742 | ||
| Scape | 18.4 | 73.3* | 8.3 | 2.2168674 | 8.831326 |
| Brain | |||||
| Crop | 69.4* | 30.6 | 2.267974 | ||
| Eye | |||||
| Intestine | 53.9 | 46.1 | 1.1691974 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 90.7 | 9.3 | 9.752688 | ||
| Mandibular gland | 4.4 | 88.8* | 6.8 | 0.64705884 | 13.058824 |
| Rectum | |||||
| Salivary gland, cerebral | 98.8* | 1.2 | 82.333336 | ||
| Salivary gland, thoracic | 26.5 | 27.7 | 45.8 | 0.5786026 | 0.6048035 |
| Sternite | 13.5 | 62.6 | 23.9 | 0.56485355 | 2.619247 |
| Tergite | 1* | 42 | 57 | 0.01754386 | 0.7368421 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 7.7 | 46.8 | 45.5 | 0.16923077 | 1.0285715 |
| Malpighian tubules | 22.9 | 38.6 | 38.5 | 0.5948052 | 1.0025975 |
| Nerve chord | 4.3 | 75 | 20.7 | 0.20772947 | 3.6231885 |
| Poison sac | |||||
| Sting | 36.2 | 63.8 | 0.56739813 | ||
| Heart | 2.1* | 46.8 | 51.1 | 0.04109589 | 0.9158513 |
| Hypopharyngeal gland | 81.7 | 18.3 | 4.464481 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.9 | 57.1 | 31.2 | 0.9583333 | 1.8301282 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTTLNINELTIVKRNLHVPSLDEIKDVLKEGLIKNFANVEVEIVDCPDLTQEPFTLSAPG LSGNSTVLEIGGPSFLLPTVQKNKLYDIQQLLNHLHYKEDSFVIGAGAGPWPHINSNCEL IMNMVVSLSNVQNGTHISYVNKGNGNCELQNLPNNETRFALLANLFVTEGKPGKVLKIHV KKRVGNDDFIACMQKAIAQNYHNNLVGLGGTFLIKNGKVKQHVMPDFSATPLRTEAQLNN WLHFYNMSTPLIAVGTFVSSESDLDLRVQHFHSFSHHGEGGHYHIDTTPETIEYLGYFNL GTTLYRIDKPLTGVEFGKD |
 Top
| |