| Protein: 110767982 XP_624411.2 PREDICTED: hypothetical protein LOC552027 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.8* | 73.2 | 0.36612022 | ||
| Scape | 45.4 | 21.4 | 33.2 | 1.3674699 | 0.64457834 |
| Brain | |||||
| Crop | 67.1 | 32.9 | 2.0395136 | ||
| Eye | |||||
| Intestine | 54.8 | 45.2 | 1.2123893 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 62.2 | 25.8 | 11.9 | 5.2268906 | 2.1680672 |
| Salivary gland, thoracic | 42.1 | 13 | 44.9 | 0.9376392 | 0.2895323 |
| Sternite | 23.6 | 43.7 | 32.8 | 0.7195122 | 1.3323171 |
| Tergite | 32.2 | 53.4 | 14.4 | 2.2361112 | 3.7083333 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 54.3 | 33.2 | 12.5 | 4.344 | 2.656 |
| Malpighian tubules | 47 | 25.5 | 27.5 | 1.709091 | 0.92727274 |
| Nerve chord | 50.5 | 12.7 | 36.8 | 1.3722826 | 0.3451087 |
| Poison sac | |||||
| Sting | |||||
| Heart | 38 | 36.5 | 25.5 | 1.4901961 | 1.4313725 |
| Hypopharyngeal gland | 26.7 | 73.3 | 0.36425647 | ||
| Galea | 20.7 | 79.3 | 0.26103404 | ||
| Glossa | 17.5 | 82.5 | 0.21212122 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.9 | 31.9 | 41.7 | 1.0527577 | 0.764988 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVKMEHDDGKNEPEHVRKLFIGGLDYRTTDDSLKKHFEKWGEIVDVVVMKDPKTKRSRGF GFITYSRAHMVDDAQNARPHKVDGRVVEPKRAVPRQEIGRPEAGATVKKLFVGGLKDDHE EDDLKQYFQSYGTINSISIVTDKETGKKRGFGFVEFDDYDPVDKICLQRNHQIRGKHVDV KKALSKAEMASASGGGGGSGGGGSRGGQNVGRGPRGGNQGGGNWGGRGSGGGGDWNNGGN QGGYGGGNQGGWGGNGPWENQNQGGGWGGQGGQGGYNSGGNWSNDNFGGGYQQGYGGGPV RNNFNSGGRPAPYGINMGPSGRQSGDSRWLPPFGGQGPMGGGNSGGGGGGYGNQGGYGGS SLGGGNMGGGGGGGGRRY |
 Top
| |