![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328791592 XP_003251597.1 PREDICTED: putative fatty acyl-CoA reductase CG5065-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 2.3* | 1.6* | 96.1 | 0.023933403 | 0.016649324 |
| Tergite | 1.3* | 18.9 | 79.7 | 0.016311167 | 0.23713927 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 0.7* | 16.4 | 82.9 | 0.008443908 | 0.19782871 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 1.6 | 50.7 | 47.6 | 0.033613443 | 1.0651261 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 1.5 | 21.9 | 76.6 | 0.019582245 | 0.28590077 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSNFITDTKSMECVSIATFYAGRNIFITGGSGFLGKVLIEKLLRSCPEIGHIFILMRPKK GLSIDDRLKKMLELPLFDKLRKENHSSFEKLIPVLGDISNEDLGLSKNERQTLIEQVSII FHIAANVRFEGNLKKDIFSNVRSTRDICILAKSMKNLVALVHISTAYAHVDKPVIDEIVY PSLVDWRNIIKMVETLDEQIIEVFTSKYLGSMPNTYTFSKRIAEQVINDYSKDLPTVIIR PSIVTSTINDPIPGWLDNFNGPVAIMIGGAKGILRVIQLKSDVCGDFLPVDLAIKIMIIA AWKRGLNTITKDPTTYVYNATSNQIHRISHKRMIKLGLKLNKEMPLEGIIWYPQTFITSN YFVYFILTLLIHMIPALIIDEILKIMGRQPMLLKIHKIIYSHVTHLNYFLHNEWTFNNFK VLDIFDMQVPLAEQEIFSYDYRNFNINEYFKNCMTGAKCYLLKEDLNRLKEVKQHFNRMQ WINRIFNIWLIIMLMWILGKIGIFSYFSN |
|
| |