| Protein: 66511554 XP_393207.2 PREDICTED: glucosylceramidase-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.4 | 30.1 | 39.5 | 0.76962024 | 0.7620253 |
| Scape | 2* | 82.4* | 15.6 | 0.12820512 | 5.282051 |
| Brain | 87.6* | 12.4 | 7.064516 | ||
| Crop | |||||
| Eye | 1.8* | 98.2 | 0.018329939 | ||
| Intestine | 9.2* | 90.8 | 0.10132159 | ||
| Leg, front | 26 | 44.9 | 29 | 0.8965517 | 1.5482758 |
| Leg, middle | 13.6* | 34.3 | 52.2 | 0.2605364 | 0.6570881 |
| Leg, rear | |||||
| Mandibular gland | 0.7 | 82 | 17.4 | 0.040229887 | 4.7126436 |
| Rectum | 6.4 | 8.2 | 85.4 | 0.07494145 | 0.09601873 |
| Salivary gland, cerebral | 9.5 | 90.5 | 0.10497238 | ||
| Salivary gland, thoracic | |||||
| Sternite | 3.6 | 66 | 30.4 | 0.11842106 | 2.1710527 |
| Tergite | 3.1 | 55.1 | 41.8 | 0.07416268 | 1.3181819 |
| Ventriculus | 60.6 | 39.4 | 1.538071 | ||
| Thoracic muscle | |||||
| Fat body | 8.1 | 23.8 | 68.1 | 0.11894273 | 0.34948605 |
| Malpighian tubules | |||||
| Nerve chord | 89.5* | 10.5 | 8.523809 | ||
| Poison sac | 92.6* | 7.4 | 12.513514 | ||
| Sting | 86.6* | 13.4 | 6.4626865 | ||
| Heart | 18 | 38.7 | 43.3 | 0.4157044 | 0.89376444 |
| Hypopharyngeal gland | 1.6* | 98.4 | 0.016260164 | ||
| Galea | 87.6* | 12.4 | 7.064516 | ||
| Glossa | 0.4* | 86.5* | 13.1 | 0.030534351 | 6.6030536 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 13.4 | 53.5 | 43.3 | 0.30946884 | 1.2355658 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIQEIVKNRKIMWKAVLLIAILSAATNKSVANDCVPRSFGTNNIVCVCNSTYCDSTPEPK PSSPEKGTFHWYVSSRDGLRLSLSKGQMGRCQNDGSLTLNIDTSKRYQTILGFGGAFTDS AGMNIKNLSEATQDQLIRAYFDPKDGSRYTLGRIPIGGTDFSTRAYTLDDYDDDATLQHF ALAPEDVEYKIPYARKAVELNPDLRFFSAAWSAPTWMKTNHKINGFGFLKTEYYQTFANY ILKFIEEYKKNGVDIWGVSTGNEPFDAYIPFERLNSMGWTPELVGDWIANNLGPTLANSE YNATHIFVLDDQRLGLPWFVNEIFKNEIARNYVYGIAVHWYADILIPPVVLDQTHNNFPD KNLLMTEACEGSFPLEKKVVLGSWERGKRYILSITQYMNHWGVGWVDWNIALNKDGGPTY INNNVDSPIIVNPENDEFYKQPMYYALKHYSRFVDRGSVRIFITDTIEIKAAAFITPSNE IVVVAYNDNNEKTNVVLNDVTSEDYICLELPPHSMNTVIYNK |
 Top
| |