| Protein: 328777153 XP_001120676.2 PREDICTED: LOW QUALITY PROTEIN: endocuticle structural glycoprotein SgAbd-1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 23.9 | 50.5 | 25.6 | 0.93359375 | 1.9726562 |
| Scape | 40.4 | 29.9 | 29.8 | 1.3557047 | 1.0033557 |
| Brain | |||||
| Crop | 62.2 | 4.1* | 33.7 | 1.8456973 | 0.12166172 |
| Eye | 15.3 | 30.6 | 54 | 0.28333333 | 0.56666666 |
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 33.5 | 30.7 | 35.8 | 0.9357542 | 0.8575419 |
| Rectum | |||||
| Salivary gland, cerebral | 86.1* | 13.9 | 6.1942444 | ||
| Salivary gland, thoracic | 79.4* | 20.6 | 3.854369 | ||
| Sternite | 42.6 | 27.3 | 30.1 | 1.4152824 | 0.90697676 |
| Tergite | 17.8 | 25.6 | 56.6 | 0.31448764 | 0.45229682 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | 1.1 | 98.9 | 0.011122346 | ||
| Sting | 69.9 | 30.1 | 2.3222592 | ||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 38.7 | 29.1 | 32.2 | 1.2018634 | 0.9037267 |
| Glossa | 22.8 | 53.3 | 23.9 | 0.9539749 | 2.2301254 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33 | 39.8 | 37.3 | 0.8847185 | 1.0670241 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MHWSEEVHCEXRAGMTPFTAPRCYGRVYKEAKHLTKKHKYQPIHPNRFIAGVRVTEREIM FTIKALVAVVLCTTATLAAPQRPSGGADKDAVITSQQLEVNFDGNYINNFETSNGISHQE SGQPKQVDNETPVVSQGSDSYTAPDGQQVSITYVADENGFQVQGSHIPTAPPIPPEIQRA LEWNAAHPEEDDGGQPRPPGRG |
 Top
| |