| Protein: 48142798 XP_393614.1 PREDICTED: 60S ribosomal protein L7 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 43 | 57 | 0.75438595 | ||
| Scape | 45.6 | 28.2 | 26.2 | 1.740458 | 1.0763359 |
| Brain | |||||
| Crop | 26.4 | 42 | 31.7 | 0.8328076 | 1.3249211 |
| Eye | 59.9 | 40.1 | 1.4937656 | ||
| Intestine | 58.8 | 41.2 | 1.4271845 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 67.3 | 32.7 | 2.058104 | ||
| Salivary gland, thoracic | 31.2 | 30.3 | 38.5 | 0.81038964 | 0.787013 |
| Sternite | 16.7 | 47.5 | 35.8 | 0.46648043 | 1.3268156 |
| Tergite | 94.9* | 5.1 | 18.607843 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 32.2 | 32 | 35.8 | 0.89944136 | 0.89385474 |
| Malpighian tubules | 34.5 | 30 | 35.5 | 0.97183096 | 0.8450704 |
| Nerve chord | 44 | 56 | 0.78571427 | ||
| Poison sac | |||||
| Sting | 59.5 | 40.5 | 1.4691358 | ||
| Heart | 9.7 | 54.9 | 35.4 | 0.27401128 | 1.5508474 |
| Hypopharyngeal gland | 10.3 | 89.7 | 0.1148272 | ||
| Galea | 56.6 | 43.4 | 1.3041475 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.6 | 45.4 | 40.3 | 0.8833747 | 1.1265509 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRISLPSGRMAVPKKESEPVAKKLPAVPESVLKRRKTREAVRAARLQISIKQRANRYKKR KAIFKRAEKYVKEYRTKERDEIRLMRQAKNRGNYYIPGEARLAFVIRIRGVNQVAPKVRK VLQLFRLKQINNGVFVKLNKATINMLRIVEPYITWGYPNLKSVRELIYKRGFAKINRQRI PITSNSIIEKKLGRSGIICIEDLIHEIFTVGPKFKFASNFLWPFKLNTPNGGWRKKTNHY VEGGDFGNREDKINELLRRMV |
 Top
| |