| Protein: 48095594 XP_394484.1 PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.8 | 59.2 | 0.6891892 | ||
| Scape | 39.8 | 21.1 | 39.1 | 1.0179029 | 0.5396419 |
| Brain | 29.7 | 70.3 | 0.4224751 | ||
| Crop | 66 | 34 | 1.9411764 | ||
| Eye | |||||
| Intestine | 31.3 | 68.7 | 0.45560408 | ||
| Leg, front | 46.5 | 9.9* | 43.6 | 1.0665138 | 0.22706422 |
| Leg, middle | 49 | 51 | 0.9607843 | ||
| Leg, rear | 27.7 | 35.8 | 36.5 | 0.7589041 | 0.9808219 |
| Mandibular gland | |||||
| Rectum | 33.5 | 66.5 | 0.5037594 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 38.7 | 17.5 | 43.8 | 0.8835617 | 0.39954337 |
| Sternite | |||||
| Tergite | 78.1 | 21.9 | 3.56621 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 32 | 29.8 | 38.2 | 0.8376963 | 0.7801047 |
| Malpighian tubules | 85.8* | 14.2 | 6.0422535 | ||
| Nerve chord | 26.9 | 73.1 | 0.36798906 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 20.8 | 41.1 | 38.1 | 0.54593176 | 1.0787401 |
| Hypopharyngeal gland | 65.6 | 34.4 | 1.9069767 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.7 | 36.8 | 45.8 | 0.9104803 | 0.80349344 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGCFGSQSSKASQDDSKNQKRRSDAITRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQM RILHVDGFSEAEKRQKIEDIKKNIRDAILTITGAMSTLTPPVALEDPANQSKVDYIQEVS NSPDFDYPPEFYDIVEALWKDRGVQQSFERSNEYQLIDCAKYFLDKVAIVKQPDYTPTEQ DILRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNM VLREDPTKLRLRESLDLFKSIWNNRWLRTISVILFLNKQDLLAEKIKAGKHKLEDYFPDF ARYQTPVDAGVVVDPSEPPDVMRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIK RVFNDCRDIIQRMHLRQYELL |
 Top
| |