| Protein: 328781117 XP_624798.3 PREDICTED: glycogenin-1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 30.2 | 34.1 | 35.6 | 0.8483146 | 0.9578652 |
| Brain | |||||
| Crop | 82.8* | 17.2 | 4.8139534 | ||
| Eye | 9.7 | 43.5 | 46.8 | 0.20726496 | 0.92948717 |
| Intestine | |||||
| Leg, front | 32.6 | 31.6 | 35.8 | 0.91061455 | 0.88268155 |
| Leg, middle | 29.9 | 35.3 | 34.8 | 0.8591954 | 1.0143678 |
| Leg, rear | 13.8 | 38.3 | 48 | 0.2875 | 0.79791665 |
| Mandibular gland | 9.4 | 90.6 | 0.10375276 | ||
| Rectum | |||||
| Salivary gland, cerebral | 5.4* | 10.9 | 83.7 | 0.06451613 | 0.130227 |
| Salivary gland, thoracic | 36.8 | 36.2 | 27 | 1.362963 | 1.3407408 |
| Sternite | 71.4* | 22 | 6.6 | 10.818182 | 3.3333333 |
| Tergite | 86.3 | 6.9 | 6.7 | 12.880597 | 1.0298507 |
| Ventriculus | |||||
| Thoracic muscle | 41 | 59 | 0.69491524 | ||
| Fat body | |||||
| Malpighian tubules | 20.4* | 79.6 | 0.2562814 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 67.9 | 32.1 | 2.115265 | ||
| Hypopharyngeal gland | |||||
| Galea | 18.6 | 31.8 | 49.6 | 0.375 | 0.641129 |
| Glossa | 11.7 | 45.8 | 42.5 | 0.27529413 | 1.0776471 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.2 | 33.8 | 43.5 | 0.7632184 | 0.7770115 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGGYAWVTLATNDAYSLGALVLAHSLRRVGTKYELAVLITPGVTQIMREKLLGIFSVVME VNVLDSKDEANLALLARPELGITFTKLHCWRLIQYEKCVFLDADTLVVRNCDELFEREEL SAAPDVGWPDCFNSGVFVYRPSQQTFASITAFAAAKGSFDGGDQGLLNMYFSDWARKDIS KHLPFIYNMCSTATYSYLPAFKQFGDDVRIIHFIGITKPWLQYFDTLTGVVQPPMGSIHL QPLLQLWWNIFCEKVHSQLSPVMAGLAGALAQMTLGEPRSSEQIALEEHMRKQSWEQGQI DYMGRDSFDNIWKKICETLALAPPRLPSPPKEIRKSVKNKIDETDEFIKSAETTQFIKST DEVDKRTGTEDSN |
 Top
| |