| Protein: 328787585 XP_003250973.1 PREDICTED: isocitrate dehydrogenase [NAD] subunit gamma 1 mitochondrial-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 7.4* | 50.3 | 42.2 | 0.17535545 | 1.1919432 |
| Scape | 27 | 30.9 | 42.1 | 0.6413302 | 0.73396677 |
| Brain | |||||
| Crop | 23.7 | 41.7 | 34.6 | 0.6849711 | 1.2052023 |
| Eye | |||||
| Intestine | 30.9 | 25.4 | 43.6 | 0.7087156 | 0.5825688 |
| Leg, front | 34.7 | 15* | 50.2 | 0.69123507 | 0.2988048 |
| Leg, middle | 36 | 14.5* | 49.5 | 0.72727275 | 0.2929293 |
| Leg, rear | 27.1 | 23.1 | 49.9 | 0.5430862 | 0.46292585 |
| Mandibular gland | 74.1 | 25.9 | 2.8610039 | ||
| Rectum | 76.8 | 23.2 | 3.310345 | ||
| Salivary gland, cerebral | 5.8* | 14.2 | 80 | 0.0725 | 0.1775 |
| Salivary gland, thoracic | 28.6 | 42.7 | 28.7 | 0.9965157 | 1.4878049 |
| Sternite | 38 | 46.5 | 15.5 | 2.451613 | 3 |
| Tergite | 67.4 | 12.5 | 20.1 | 3.3532338 | 0.62189054 |
| Ventriculus | |||||
| Thoracic muscle | 7.6 | 31.7 | 60.7 | 0.12520593 | 0.5222405 |
| Fat body | 30.2 | 56.1* | 13.7 | 2.2043796 | 4.0948906 |
| Malpighian tubules | 38.3 | 32.5 | 29.2 | 1.3116438 | 1.1130137 |
| Nerve chord | 22.8 | 35.2 | 42 | 0.54285717 | 0.83809525 |
| Poison sac | |||||
| Sting | 51.6 | 48.4 | 1.0661157 | ||
| Heart | 47.4 | 20.8 | 31.8 | 1.490566 | 0.654088 |
| Hypopharyngeal gland | 92.2 | 7.8 | 11.820513 | ||
| Galea | 24 | 31.3 | 44.7 | 0.53691274 | 0.7002237 |
| Glossa | 27.2 | 20.2 | 52.6 | 0.5171103 | 0.38403043 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.8 | 34.4 | 38 | 0.8894737 | 0.9052632 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAARSIIKYLRPKTVVSQIHRCASLSAFEIQHKTPTIKKVMPIPKAHYGGRHTVTLLPGA GIGPELMNYVKEIFRYAGVPVDFEDVEIDPNANDNVDLDYAITSIRRNGVALKGNIETRS TEADVLSRNVALRNELDLYVNVLHCVSYPGVNSRHKNIDIVIVRQNTEGEYAMLEHESVK GVVESMKVITSINSERVARYAFEYAKRNGRKKITTVHKANIMKLSDGLFLEISRKVAKDY PDITHNDMIIDNTCMQLVSNPHQFDIILTTNLYGAIVSNVVCGLLGGAGLLAGKNFGDHY TVFEPGTRNTGKRIAGKNIANPIAMLNAAVDMLRHLGHKDHATLIQNAINKTINQGVHTP DLGGQATSREVVDTIMNHIKIASN |
 Top
| |