| Protein: 328777427 XP_003249340.1 PREDICTED: hypothetical protein LOC409479 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.5 | 55.5 | 0.8018018 | ||
| Scape | 40.3 | 33.5 | 26.2 | 1.538168 | 1.278626 |
| Brain | |||||
| Crop | 30.5 | 35.6 | 34 | 0.89705884 | 1.0470588 |
| Eye | 6.2 | 93.8 | 0.06609808 | ||
| Intestine | 54.8 | 45.2 | 1.2123893 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 80.9 | 19.1 | 4.235602 | ||
| Salivary gland, thoracic | 33.5 | 26.6 | 40 | 0.8375 | 0.665 |
| Sternite | 16 | 47.6 | 36.4 | 0.43956044 | 1.3076923 |
| Tergite | 37.7 | 62.3 | 0.60513645 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 33.6 | 30.5 | 35.9 | 0.9359332 | 0.8495822 |
| Malpighian tubules | 30.2 | 31.8 | 38 | 0.79473686 | 0.8368421 |
| Nerve chord | 38.5 | 18.7 | 42.8 | 0.89953274 | 0.43691587 |
| Poison sac | |||||
| Sting | 54.1 | 45.9 | 1.1786492 | ||
| Heart | 19.1 | 49.9 | 31 | 0.61612904 | 1.6096774 |
| Hypopharyngeal gland | 8.9 | 91.1 | 0.097694844 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.3 | 36.4 | 46.5 | 0.716129 | 0.7827957 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTDTKETNETKLKSPEKKEISSVKKGEKKGRIRPRNYDLGNGVYRFSRTRMFHKKAIYKF LSKKTPKSVKPKKPITIEKKISGDKNGEKRIVLLKKRRANYPTADPVTVHHAKKCFRDHR RYLRPSLKPGTICILLAGAHKGKRVVFLKQLKSGLLLITGPFLINACPLRRVSQNYVIAT STRINISGLKIPSHINDDYFKRKREKRAKKEEGDIFSKKKDEYKPSDQRKADQKVVDKFV ISAIKRNKEKKMLFTYLSAMFGLRSSQYPHRLKF |
 Top
| |