| Protein: 48099278 XP_394885.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37 | 31.3 | 31.7 | 1.1671925 | 0.9873817 |
| Scape | 41.5 | 24.1 | 34.3 | 1.2099125 | 0.7026239 |
| Brain | 32.4 | 67.6 | 0.47928995 | ||
| Crop | 28.3 | 44.6 | 27.1 | 1.0442804 | 1.6457565 |
| Eye | 49.1 | 50.9 | 0.96463656 | ||
| Intestine | 36.3 | 26.8 | 36.9 | 0.98373985 | 0.72628725 |
| Leg, front | 30.3 | 30.7 | 39 | 0.77692306 | 0.78717947 |
| Leg, middle | 33.3 | 35.4 | 31.4 | 1.0605096 | 1.1273885 |
| Leg, rear | 17.7 | 39 | 43.3 | 0.408776 | 0.9006928 |
| Mandibular gland | 89.9* | 10.1 | 8.9009905 | ||
| Rectum | |||||
| Salivary gland, cerebral | 21.4 | 28.2 | 50.4 | 0.42460316 | 0.5595238 |
| Salivary gland, thoracic | 29.5 | 41.4 | 29.1 | 1.0137457 | 1.4226804 |
| Sternite | 34.3 | 27.5 | 38.2 | 0.89790577 | 0.7198953 |
| Tergite | 32.5 | 21.2 | 46.4 | 0.70043105 | 0.45689654 |
| Ventriculus | |||||
| Thoracic muscle | 41.2 | 58.8 | 0.70068026 | ||
| Fat body | 34.3 | 40.4 | 25.3 | 1.3557312 | 1.596838 |
| Malpighian tubules | 39.5 | 25.3 | 35.2 | 1.1221591 | 0.71875 |
| Nerve chord | 38.7 | 22.8 | 38.4 | 1.0078125 | 0.59375 |
| Poison sac | |||||
| Sting | 36 | 64 | 0.5625 | ||
| Heart | 47.6 | 18.8 | 33.6 | 1.4166666 | 0.5595238 |
| Hypopharyngeal gland | 91.5 | 8.5 | 10.764706 | ||
| Galea | 55.9 | 11 | 33.1 | 1.6888218 | 0.3323263 |
| Glossa | 49.5 | 11.7 | 38.8 | 1.2757732 | 0.3015464 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.9 | 32.8 | 37.9 | 1.0263852 | 0.86543536 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSLLKNYWKLMRNLPVTSPKCYPKLLPLTRMNTTETEKTETRPTIRKIQTDLETIKDLG LYIAACLPKYVQKTQIVAGDELEILVCPEGIIPTLKFLKLHQNTQYTSLSDITAMDVPSR QYRFEIIYNLLSITFNKRIRVKTYTDELTPVPSAEPIFDAANWYEREIWDMFGILFMGHT DLRRILTDYGFEGHPLRKDFPLSGFVEVRYDDELKRVVCEPLELAQEFRKFELSAPWEQF PNFRSIPPSDESKEDSTKDKN |
 Top
| |