| Protein: 328791540 XP_003251590.1 PREDICTED: hypothetical protein LOC100578389 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 3.2* | 68.8* | 28.1 | 0.113879 | 2.4483986 |
| Eye | |||||
| Intestine | 38.2 | 46.2* | 15.6 | 2.4487178 | 2.9615386 |
| Leg, front | 89.6* | 10.4 | 8.615385 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 34.3 | 15.8 | 49.9 | 0.6873748 | 0.31663325 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | 79.5 | 20.5 | 3.878049 | ||
| Ventriculus | 12.3 | 83.2* | 4.5 | 2.7333333 | 18.48889 |
| Thoracic muscle | |||||
| Fat body | 76.8 | 23.2 | 3.310345 | ||
| Malpighian tubules | 36.7 | 29 | 34.3 | 1.0699708 | 0.84548104 |
| Nerve chord | 38.5 | 61.5 | 0.62601626 | ||
| Poison sac | |||||
| Sting | 63.9 | 36.1 | 1.7700831 | ||
| Heart | 48.5 | 25.5 | 26 | 1.8653846 | 0.9807692 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 46.6 | 46.4 | 28.2 | 1.6524823 | 1.64539 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKCRQYVMKFASAIFVILIAASPLNAYKIPATGSGALAKELQDFIDLIPLDQIIQVTKTY YAQDTQFRNIIQLMKTEELKQWMLDIESAPEFKLLINYVQKNGLDIYYLVNEFNKSLNLP PLVSGIKAFFGSFDNKITGGFIGYLIDIAALVPLEKLSDLFTEKSKNSEVFKAFIAEVSS SKYFDFYNNIFEDKHYKNLENDAINLGVTRNDFHTFSPIFVIAATAFK |
 Top
| |