| Protein: 328787761 XP_394680.3 PREDICTED: proteasome subunit beta type-5-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 47.5 | 21.4 | 31.1 | 1.5273312 | 0.6881029 |
| Scape | 29 | 34.2 | 36.9 | 0.78590786 | 0.9268293 |
| Brain | |||||
| Crop | 23.6 | 41.3 | 35.1 | 0.67236465 | 1.1766381 |
| Eye | 44.9 | 26.9 | 28.2 | 1.5921986 | 0.9539007 |
| Intestine | 35.7 | 35.1 | 29.2 | 1.2226027 | 1.2020547 |
| Leg, front | 27.8 | 33 | 39.2 | 0.7091837 | 0.84183675 |
| Leg, middle | 31 | 37.2 | 31.8 | 0.9748428 | 1.1698114 |
| Leg, rear | 38.5 | 23.1 | 38.4 | 1.0026041 | 0.6015625 |
| Mandibular gland | 11.9 | 88.1 | 0.13507378 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 38.4 | 26 | 35.5 | 1.0816902 | 0.73239434 |
| Sternite | 26.6 | 43.8 | 29.5 | 0.9016949 | 1.4847457 |
| Tergite | 36.5 | 63.5 | 0.5748032 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 19.2 | 40.6 | 40.1 | 0.47880298 | 1.0124688 |
| Malpighian tubules | 31.3 | 30.1 | 38.6 | 0.81088084 | 0.7797927 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 21 | 41.8 | 37.2 | 0.5645161 | 1.1236559 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 32.8 | 67.2 | 0.48809522 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.9 | 33.4 | 41.9 | 0.73747015 | 0.797136 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALAEVCGLKSFVDFNNSREEDYYLREIQGYSKNFINNAQLAIPPYINPAEKLAHFAEAP DEAGKHLKIRFDHGTTTLGFQYQGGIILAVDSRATGGQFIGSSTMKKIVEINDYLLGTLA GGAADCVYWDRVLAKQCRTYELRNRERISIAAASKLLSNMIYNYKGMGLSIGMMLAGWDK RGPSLYYVDSEGARTPGKVFSVGSGSIYAFGTLDSGYRWDLSDEEAYQLGKRSIYHATHR DAYSGGIVRVYHIKPTGWVHISDEDCKELHYMYQEQKEKKLN |
 Top
| |