| Protein: 328791879 XP_001120420.2 PREDICTED: ATP synthase subunit g mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.9 | 21.1 | 40 | 0.9725 | 0.5275 |
| Scape | 46.3 | 32.6 | 21.1 | 2.1943128 | 1.5450237 |
| Brain | 33.7 | 23.2 | 43 | 0.7837209 | 0.53953487 |
| Crop | 31.5 | 41.5 | 27 | 1.1666666 | 1.537037 |
| Eye | 28.8 | 21.7 | 49.5 | 0.58181816 | 0.43838385 |
| Intestine | 31.4 | 26.1 | 42.5 | 0.73882353 | 0.6141176 |
| Leg, front | 30.8 | 23.4 | 45.9 | 0.67102396 | 0.50980395 |
| Leg, middle | 32.3 | 24.6 | 43.1 | 0.7494199 | 0.5707657 |
| Leg, rear | 23.7 | 32.8 | 43.5 | 0.5448276 | 0.754023 |
| Mandibular gland | 51.4 | 7 | 41.6 | 1.2355769 | 0.16826923 |
| Rectum | 46.1 | 53.9 | 0.85528755 | ||
| Salivary gland, cerebral | 36.3 | 24.9 | 38.8 | 0.935567 | 0.6417526 |
| Salivary gland, thoracic | 24.6 | 47.1 | 28.3 | 0.8692579 | 1.6643109 |
| Sternite | 23.2 | 51.2 | 25.6 | 0.90625 | 2 |
| Tergite | 37.8 | 17.7 | 44.5 | 0.8494382 | 0.39775282 |
| Ventriculus | |||||
| Thoracic muscle | 21.2 | 58.9 | 19.9 | 1.0653267 | 2.959799 |
| Fat body | 35.6 | 28.5 | 35.9 | 0.9916434 | 0.7938719 |
| Malpighian tubules | 33.3 | 30.8 | 35.9 | 0.9275766 | 0.8579387 |
| Nerve chord | 11.6 | 55.4 | 33 | 0.35151514 | 1.6787878 |
| Poison sac | |||||
| Sting | 48.3 | 51.7 | 0.934236 | ||
| Heart | 32.5 | 34 | 33.6 | 0.9672619 | 1.0119047 |
| Hypopharyngeal gland | 56.6 | 43.4 | 1.3041475 | ||
| Galea | 50.4 | 11.9 | 37.7 | 1.3368701 | 0.31564987 |
| Glossa | 57 | 20.2 | 22.7 | 2.5110133 | 0.88986784 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.5 | 32.1 | 37.6 | 0.9175532 | 0.8537234 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSKIVGEVSTLIKLGVTKSGPALRKFTYYAKVELVPPKISDIPAIRNGFQNLITSVKEKR FLHLTVREAWLNTLVGIEVLCWFFVGECIGKRHLAGYKLNFNYINKH |
 Top
| |