| Protein: 328784401 XP_396252.3 PREDICTED: moesin/ezrin/radixin homolog 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 13.3* | 33.5 | 53.2 | 0.25 | 0.62969923 |
| Scape | 26.4 | 39.1 | 34.5 | 0.76521736 | 1.1333333 |
| Brain | |||||
| Crop | 55 | 20.4 | 24.6 | 2.2357724 | 0.8292683 |
| Eye | 84.8 | 15.2 | 5.5789475 | ||
| Intestine | 35.1 | 34.8 | 30.1 | 1.1661129 | 1.1561462 |
| Leg, front | 25.3 | 17.1* | 57.6 | 0.4392361 | 0.296875 |
| Leg, middle | 35.8 | 15.1* | 49.1 | 0.72912425 | 0.30753565 |
| Leg, rear | 25.8 | 19.3 | 54.9 | 0.46994534 | 0.35154828 |
| Mandibular gland | 58.5 | 41.5 | 1.4096385 | ||
| Rectum | 78.5 | 21.5 | 3.6511629 | ||
| Salivary gland, cerebral | 56.8 | 19.2 | 24 | 2.3666666 | 0.8 |
| Salivary gland, thoracic | 53.5 | 11.2 | 35.3 | 1.5155808 | 0.31728044 |
| Sternite | 32.3 | 43 | 24.7 | 1.3076923 | 1.7408907 |
| Tergite | 39.9 | 31.7 | 28.4 | 1.4049295 | 1.1161972 |
| Ventriculus | 38.9 | 61.1 | 0.63666123 | ||
| Thoracic muscle | |||||
| Fat body | 46.5 | 32.1 | 21.4 | 2.172897 | 1.5 |
| Malpighian tubules | 23.1 | 47.1 | 29.9 | 0.77257526 | 1.5752509 |
| Nerve chord | 35.7 | 32.7 | 31.6 | 1.1297468 | 1.0348102 |
| Poison sac | |||||
| Sting | 52.3 | 47.7 | 1.096436 | ||
| Heart | 25.9 | 32.3 | 41.8 | 0.6196172 | 0.77272725 |
| Hypopharyngeal gland | 43.1 | 56.9 | 0.75746924 | ||
| Galea | 24 | 26.9 | 49 | 0.48979592 | 0.5489796 |
| Glossa | 21.3 | 23.6 | 55.1 | 0.3865699 | 0.42831215 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.9 | 32.6 | 38.7 | 0.97932816 | 0.84237725 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPKTMNVRVTTMDAELEFAIQQTTTGKQLFDQVVKTIGLREVWFFGLQYTDNKGDLTWIK LYKKPENVITRVVKKEVKKKVRKLRGRSDSDTDDDEFEDDLSGLLPFLSRVMNQEVKKET PLQFKFRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQAKH GDFQKGTHTAGFLINDRLLPQRVVDQHKMSKEEWESSITNWWQEHRGMLREDAMMEYLKI AQDLEMYGVNYFEIRNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNEKK FIIKPIDKKAPDFVFFATRVKINKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKI AKQQQREKLQLEIAARERAERKQQEYEERLRNMAEEMDRRQAELNEAQEMIRRLEEHLKQ LQAAKEELEDRQKELTAMMEKLELSHEMEAAERAKLEQEIRAKQEEIQRIQSEVVAKDAE ARRLEEVFEAAKLRQEEADRAFQANTTPHHHHVEENEEGEEEGEDEVSHGDVTKDLATDE SIIDPVEERRTLAERNERLHDQLKALKKDLAQSRDESKETVMDKIHKENVKQGRDKYKTL REIRKGNTKRRVDQFENM |
 Top
| |