| Protein: 66563168 XP_392720.2 PREDICTED: alanine aminotransferase 2-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 28.3 | 41.7 | 30 | 0.9433333 | 1.39 |
| Scape | 23.3 | 39.1 | 37.5 | 0.62133336 | 1.0426667 |
| Brain | 27.8 | 31.1 | 41.1 | 0.67639905 | 0.756691 |
| Crop | 37.7 | 22.4 | 40 | 0.9425 | 0.56 |
| Eye | 67.2 | 32.8 | 2.0487804 | ||
| Intestine | 20.8 | 43.2 | 36 | 0.5777778 | 1.2 |
| Leg, front | 33.1 | 34.3 | 32.7 | 1.0122324 | 1.0489297 |
| Leg, middle | 33.1 | 38.5 | 28.5 | 1.1614035 | 1.3508772 |
| Leg, rear | 56.1 | 19.1 | 24.8 | 2.262097 | 0.7701613 |
| Mandibular gland | 33.1 | 66.9 | 0.49476832 | ||
| Rectum | 9.4 | 67.2 | 23.4 | 0.4017094 | 2.871795 |
| Salivary gland, cerebral | 59.6 | 7.2 | 33.2 | 1.7951807 | 0.21686748 |
| Salivary gland, thoracic | 36.1 | 22.2 | 41.6 | 0.86778843 | 0.53365386 |
| Sternite | 28.1 | 44.9 | 27 | 1.0407407 | 1.6629629 |
| Tergite | 15.8 | 53.1 | 31.2 | 0.50641024 | 1.7019231 |
| Ventriculus | 42.7 | 18.8 | 38.5 | 1.1090909 | 0.48831168 |
| Thoracic muscle | 7 | 93 | 0.07526882 | ||
| Fat body | 29.3 | 30.7 | 40 | 0.7325 | 0.7675 |
| Malpighian tubules | 24 | 42 | 34 | 0.7058824 | 1.2352941 |
| Nerve chord | 26.6 | 42.2 | 31.1 | 0.8553055 | 1.3569132 |
| Poison sac | |||||
| Sting | 64 | 36 | 1.7777778 | ||
| Heart | 32.6 | 21.5 | 45.9 | 0.71023965 | 0.4684096 |
| Hypopharyngeal gland | |||||
| Galea | 57.4 | 42.6 | 1.3474178 | ||
| Glossa | 17 | 55.6 | 27.5 | 0.6181818 | 2.0218182 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.6 | 39.2 | 38.1 | 0.7769029 | 1.0288714 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPQARWWNAVIASSRPRTWEQLTASSSAGSGTSTGRTSICPTTEVVIHRPATVRTLHRGM ASSQSGTKILTEDNVFTNLRKMEYAVRGPLLLRALEIEKELQKGVKKPFKEVIKANVGDA HAMGQQPITFLRQVLTLTVSPNLLNDPNYPEDVKDRAKTILYHCKGGSIGSYSESAGIEI IRKHIAQYIQDRDGIPSDYHNIILSNGASDGIKSFLKLFNEKIDGKPSGVMIPIPQYPLY SATLAEFGLAQIGYYLNEENKWALDISELDRALNESRRMCNPRVLVVINPGNPTGQVLTR TNIEDIIRFAYKNHLFLLADEVYQDNVYDKDSAFHSFKKVMTEMGEPYCKMELASFMSIS KGYMGECGIRGGYGEIINMDPKVMAILLKSISAMLCPTVLGQVVMDVVVNPPKSNEPSYE LFQKEKEQTLYSLAERSKLVVDTLNTIPGFKVNPAMGAMYVFPRIDLPKKAIEVAEREGQ QPDVFYAFKLLESTGICVIPGSGFGQQPGTYHFRTTILPQKEKIKTMLECLKQFHLKFLE EYK |
 Top
| |