| Protein: 66518853 XP_391880.2 PREDICTED: elongation factor Tu mitochondrial-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 21.5 | 35.4 | 43.2 | 0.4976852 | 0.8194444 |
| Scape | 28.2 | 32.5 | 39.3 | 0.71755725 | 0.826972 |
| Brain | |||||
| Crop | 21.9 | 46.2 | 31.8 | 0.6886792 | 1.4528302 |
| Eye | |||||
| Intestine | 42.1 | 24 | 33.9 | 1.2418879 | 0.7079646 |
| Leg, front | 27.9 | 31.6 | 40.5 | 0.6888889 | 0.7802469 |
| Leg, middle | 28.6 | 37.5 | 33.9 | 0.8436578 | 1.1061947 |
| Leg, rear | 17.3* | 82.7 | 0.20918985 | ||
| Mandibular gland | 33.2 | 66.8 | 0.497006 | ||
| Rectum | 15.4 | 84.6 | 0.18203309 | ||
| Salivary gland, cerebral | 69.1 | 5.4 | 25.4 | 2.7204723 | 0.21259843 |
| Salivary gland, thoracic | 25.5 | 40.3 | 34.2 | 0.74561405 | 1.1783626 |
| Sternite | 24.6 | 75.4 | 0.32625994 | ||
| Tergite | 90.9 | 9.1 | 9.989011 | ||
| Ventriculus | |||||
| Thoracic muscle | 81.4 | 18.6 | 4.376344 | ||
| Fat body | 30.5 | 38.4 | 31.1 | 0.9807074 | 1.2347267 |
| Malpighian tubules | 35 | 34.5 | 30.4 | 1.1513158 | 1.1348684 |
| Nerve chord | 39 | 21.8 | 39.2 | 0.99489796 | 0.5561224 |
| Poison sac | |||||
| Sting | 48.8 | 51.2 | 0.953125 | ||
| Heart | 37.9 | 26.7 | 35.4 | 1.0706215 | 0.7542373 |
| Hypopharyngeal gland | 58 | 42 | 1.3809524 | ||
| Galea | 28.9 | 71.1 | 0.40646976 | ||
| Glossa | 63.5 | 36.5 | 1.7397261 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39 | 34.4 | 43.5 | 0.8965517 | 0.7908046 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALRCTKIICDSGFRYTIKQPFLVEYFVKQFYGQSRAGTYLSGVITQKFYSTKKVFNRTK PHCNVGTIGHVDHGKTTLTAAITKVLAEKELAEAKDYADIDNAPEEKERGITINVAHVEY QTEKRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGTMPQTREHLLLAKQIGIQH IVTFINKVDVADEEMVDLVEMELRELLSEMGYDGDNIPFIKGSALCALNNSNPKIGHDSI LKLLEAVDDYIPTPIRDLDKPFLLPIENVYTISGRGTVVTGRLERGKIKKGMDCELLGFN KMIKSTITGIEMFHQTLEEAEAGDQMGALLRGLKRDEVRRGMVLCKPGTMKANDHLECQV YMLTSAEGGKRKPINNLVQIQMFCKTWDCASQLNLVDKTLVMPGEDSTIRLKLIRPMVCE KGQRFTLRDGKVTIATGVITNILPKLNEHERLEILEGKKKGLKKEMAKA |
 Top
| |