| Protein: 110756609 XP_001120220.1 PREDICTED: protein NPC2 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 93.2* | 6.8 | 13.705882 | ||
| Eye | |||||
| Intestine | 0.3* | 95.4* | 4.3 | 0.069767445 | 22.186047 |
| Leg, front | 54.6 | 45.4 | 1.2026432 | ||
| Leg, middle | 5.5* | 43.1 | 51.4 | 0.10700389 | 0.8385214 |
| Leg, rear | 3.4* | 96.6 | 0.035196688 | ||
| Mandibular gland | |||||
| Rectum | 7.1 | 3.1 | 89.9 | 0.07897664 | 0.03448276 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | 48.7 | 40 | 11.3 | 4.3097343 | 3.539823 |
| Ventriculus | 11.4* | 87.8* | 0.7 | 16.285715 | 125.42857 |
| Thoracic muscle | |||||
| Fat body | 90.9 | 0.7* | 8.4 | 10.821428 | 0.083333336 |
| Malpighian tubules | 9.8* | 20.1* | 70.1 | 0.13980028 | 0.28673324 |
| Nerve chord | 3.6 | 86.8* | 9.7 | 0.371134 | 8.948454 |
| Poison sac | |||||
| Sting | 49.1 | 50.9 | 0.96463656 | ||
| Heart | 18.5 | 50.3 | 31.2 | 0.59294873 | 1.6121795 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 3.3* | 96.7 | 0.034126163 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 18.4 | 52 | 41 | 0.44878048 | 1.2682927 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAILTYVYVFAVLFIANSMQAYVPCDGKPAPTNVKILGCDTLPCNLVRGTNVEANVDFKA VANTKTLRPVVDVDLGNSHMQYPLPEQNACKNLVNGQCPLQSGQAATYYLKMPVLKAYPK VALTIQLSLVDENNNSEVCFKIPAKVVD |
 Top
| |