| Protein: 66520165 XP_623053.1 PREDICTED: 26S protease regulatory subunit 8 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 37.2 | 22.8 | 40.1 | 0.9276808 | 0.56857854 |
| Brain | |||||
| Crop | 32.1 | 30.3 | 37.6 | 0.8537234 | 0.80585104 |
| Eye | |||||
| Intestine | 26.6 | 38.3 | 35.1 | 0.75783473 | 1.091168 |
| Leg, front | 37.7 | 7.7* | 54.6 | 0.6904762 | 0.14102565 |
| Leg, middle | 34.3 | 27 | 38.7 | 0.8863049 | 0.6976744 |
| Leg, rear | 45.8 | 22.2 | 31.9 | 1.4357367 | 0.69592476 |
| Mandibular gland | |||||
| Rectum | 40.5 | 59.5 | 0.6806723 | ||
| Salivary gland, cerebral | 64.4 | 2.1 | 33.5 | 1.9223881 | 0.06268657 |
| Salivary gland, thoracic | 13.3 | 70.8* | 16 | 0.83125 | 4.425 |
| Sternite | |||||
| Tergite | 61.3 | 38.7 | 1.5839794 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 16.6 | 46.4 | 37.1 | 0.44743934 | 1.2506739 |
| Malpighian tubules | 35.4 | 18.8 | 45.8 | 0.77292573 | 0.41048035 |
| Nerve chord | 42.7 | 7.9* | 49.4 | 0.8643725 | 0.15991902 |
| Poison sac | |||||
| Sting | 54.1 | 45.9 | 1.1786492 | ||
| Heart | 22.6 | 37.4 | 40 | 0.565 | 0.935 |
| Hypopharyngeal gland | 46 | 54 | 0.8518519 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.1 | 33.3 | 41.1 | 0.8296837 | 0.810219 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTLTNKMEIDEKTMKGEGFKPYYITKIEELQLIVAEKSQNLRRLQAQRNELNAKVRMLRE ELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNSRVALRNESY TLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIA QPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREH APSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDIL DPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKG VCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK |
 Top
| |