| Protein: 66554038 XP_624913.1 PREDICTED: hypothetical protein LOC552534 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 46.7 | 53.3 | 0.8761726 | ||
| Scape | 27 | 29.5 | 43.4 | 0.62211984 | 0.6797235 |
| Brain | |||||
| Crop | 44 | 28.9 | 27 | 1.6296296 | 1.0703703 |
| Eye | |||||
| Intestine | 35 | 65 | 0.53846157 | ||
| Leg, front | 30.9 | 69.1 | 0.447178 | ||
| Leg, middle | |||||
| Leg, rear | 41.8 | 58.2 | 0.7182131 | ||
| Mandibular gland | 12 | 88 | 0.13636364 | ||
| Rectum | |||||
| Salivary gland, cerebral | 37.3 | 31.4 | 31.4 | 1.187898 | 1 |
| Salivary gland, thoracic | 29.9 | 36.5 | 33.6 | 0.88988096 | 1.0863096 |
| Sternite | 33.9 | 22.7 | 43.4 | 0.781106 | 0.5230415 |
| Tergite | 51.6 | 48.4 | 1.0661157 | ||
| Ventriculus | |||||
| Thoracic muscle | 50.7 | 49.3 | 1.0283976 | ||
| Fat body | 39.3 | 27.7 | 33.1 | 1.1873112 | 0.83685803 |
| Malpighian tubules | 31.5 | 26.2 | 42.4 | 0.7429245 | 0.6179245 |
| Nerve chord | 14.6 | 53 | 32.4 | 0.45061728 | 1.6358025 |
| Poison sac | |||||
| Sting | 63.1 | 36.9 | 1.7100271 | ||
| Heart | 26 | 41.2 | 32.8 | 0.79268295 | 1.2560976 |
| Hypopharyngeal gland | 55.9 | 44.1 | 1.2675737 | ||
| Galea | 36.1 | 27.3 | 36.5 | 0.9890411 | 0.7479452 |
| Glossa | 39.4 | 21.3 | 39.3 | 1.0025445 | 0.54198474 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.7 | 35.8 | 45.4 | 0.76431715 | 0.78854626 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAAAGSTSAGTILQKLGLKPITKCSLVKFYTPAFGVASYTALSINVMNPSLVIRIFPKKD ITNFLLGSALLGTGSYIYTRDHMKSAPTGVKILYSTAGAVLLSFGSVLVWAVLRSIVPPN PTLCTIIGIGSGLAFIKVGSSYLNFVDEQIPKK |
 Top
| |