| Protein: 328779829 XP_623287.2 PREDICTED: lysosome-associated membrane glycoprotein 1-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 33.2 | 38.1 | 28.7 | 1.1567944 | 1.3275261 |
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 61.2 | 38.8 | 1.5773196 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 8.4 | 91.6 | 0.09170306 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 45.1 | 20.5 | 34.4 | 1.3110465 | 0.5959302 |
| Sternite | 22 | 78 | 0.2820513 | ||
| Tergite | 6 | 94 | 0.06382979 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 6.7 | 25.4 | 67.9 | 0.09867452 | 0.37407953 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 53.8 | 46.2 | 1.1645021 | ||
| Hypopharyngeal gland | 23.6 | 76.4 | 0.30890054 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 19.9 | 34.9 | 61.8 | 0.32200646 | 0.5647249 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MMSKFLLLLCFTAVHVLGEDQENVLSKKNDTLLTSPRTSLQNDSEYLKANILSNKNISMT DLGIISNTENKIKQQEVIKNSLQTSTIIPNHSIVMPLDMTAISISTNETSKKISDITNPI VIHAPINSTLSSYTTGKWTVVNGTDQICIVIQMSVMFNISYVNINNKTSFITFDIPTDNV TTKASGYCGKLEQNLTLEWSAKNITNGSMTLHFMRNATENDYSLHHLEVILPASDFPSNL KLNGSVSLVHETPDFEVRLSNSYRCLKQQTLNLKQNNSNETSGYLIVSGLQFQAFKVDNS TMFGLAKDCAFDTPDVVPIAVGCALAGLVIIVLIAYLIGRRRNQAHGYLSM |
 Top
| |