| Protein: 66524760 XP_623480.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 8 mitochondrial isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 34.5 | 31.3 | 34.3 | 1.0058309 | 0.91253644 |
| Scape | 44.6 | 22.7 | 32.7 | 1.3639144 | 0.6941896 |
| Brain | |||||
| Crop | 28 | 40 | 32 | 0.875 | 1.25 |
| Eye | 30.6 | 31.9 | 37.5 | 0.816 | 0.85066664 |
| Intestine | 41.8 | 25.8 | 32.4 | 1.2901235 | 0.7962963 |
| Leg, front | 24.9 | 36.2 | 38.9 | 0.6401028 | 0.9305913 |
| Leg, middle | 43.9 | 25.1 | 30.9 | 1.420712 | 0.81229776 |
| Leg, rear | 11.3 | 34.8 | 53.9 | 0.20964749 | 0.6456401 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 20.2 | 47.1 | 32.7 | 0.617737 | 1.440367 |
| Salivary gland, thoracic | 24.9 | 46.2 | 28.9 | 0.8615917 | 1.5986159 |
| Sternite | 21 | 37.1 | 41.9 | 0.50119334 | 0.88544154 |
| Tergite | 26.3 | 14.8 | 58.9 | 0.44651952 | 0.25127333 |
| Ventriculus | |||||
| Thoracic muscle | 51.1 | 48.9 | 1.0449898 | ||
| Fat body | 43.7 | 36.8 | 19.5 | 2.2410257 | 1.8871795 |
| Malpighian tubules | 42 | 19.4 | 38.5 | 1.0909091 | 0.5038961 |
| Nerve chord | 38.5 | 13.2 | 48.3 | 0.79710144 | 0.27329192 |
| Poison sac | |||||
| Sting | 14.6 | 85.4 | 0.17096019 | ||
| Heart | 47.4 | 16.5 | 36.1 | 1.3130194 | 0.4570637 |
| Hypopharyngeal gland | 78.3 | 21.7 | 3.608295 | ||
| Galea | 46.3 | 22.6 | 31.2 | 1.4839743 | 0.724359 |
| Glossa | 49.1 | 17 | 33.9 | 1.4483776 | 0.5014749 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.3 | 30.6 | 39 | 0.9051282 | 0.7846154 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTFLKTVQPGLKLFQTYPKILNVPLRRTKYYTVYSEENKEKFLDEAVNRSFFLEIIRGLG ITMSHFFTEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIE AEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLL NNGDKWESEIASNIHADYLYR |
 Top
| |