| Protein: 328793120 XP_623864.3 PREDICTED: CAAX prenyl protease 1 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 28.5 | 31.9 | 39.6 | 0.719697 | 0.8055556 |
| Scape | 24.8 | 24.2 | 51 | 0.4862745 | 0.4745098 |
| Brain | 14.4* | 85.6 | 0.1682243 | ||
| Crop | 29.6 | 70.4 | 0.42045453 | ||
| Eye | |||||
| Intestine | 36.4 | 30 | 33.6 | 1.0833334 | 0.89285713 |
| Leg, front | 27.1 | 47 | 25.9 | 1.046332 | 1.8146719 |
| Leg, middle | 31.6 | 44.1 | 24.3 | 1.3004116 | 1.8148148 |
| Leg, rear | 37.6 | 31 | 31.4 | 1.1974522 | 0.9872611 |
| Mandibular gland | 5.5 | 94.5 | 0.05820106 | ||
| Rectum | 41.5 | 58.5 | 0.7094017 | ||
| Salivary gland, cerebral | 66.6 | 33.4 | 1.994012 | ||
| Salivary gland, thoracic | 49.4 | 19.3 | 31.4 | 1.5732484 | 0.61464965 |
| Sternite | 54.9 | 45.1 | 1.2172949 | ||
| Tergite | 38.6 | 61.4 | 0.6286645 | ||
| Ventriculus | 26.2 | 73.8 | 0.35501355 | ||
| Thoracic muscle | |||||
| Fat body | 13.1 | 17.5 | 69.4 | 0.1887608 | 0.25216138 |
| Malpighian tubules | 26.4 | 51.1 | 22.5 | 1.1733333 | 2.271111 |
| Nerve chord | 4.1* | 64.5 | 31.4 | 0.13057324 | 2.05414 |
| Poison sac | |||||
| Sting | |||||
| Heart | 4.4* | 33 | 62.6 | 0.07028754 | 0.52715653 |
| Hypopharyngeal gland | 57.7 | 42.3 | 1.3640662 | ||
| Galea | 30.7 | 28 | 41.2 | 0.7451456 | 0.6796116 |
| Glossa | 43.7 | 56.3 | 0.7761989 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30 | 35.3 | 49.3 | 0.60851926 | 0.71602434 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSFVRFIEENILYEILAISWLLFLWKFYLDLRQRVFMMRLTNLPKSLEGLMTKDVYNKA HNYLLDRLKFDSFESIYSELCTMIFLLTLCYHRFWLWSINLVKYFGFNDENEILLSGICM FILSTINDIIFLPFKVYFTFVVEQAYGFNKETPLFFAKDQLLKFIVHQIIVVPLLCAVIW IIKSGGEYCFLYLWIFLIVAALFLMIIYPEVIAPIFDKYTPLPNGDLKTKIEALAASINY PLYKIFIVENSKRSSHSNAYLYGFYKHKRIVLYDTLVKEYFKPAKDEADVKGCNTDEVLA ILAHELGHWKHSHALKGFIFGQLHLLMNIFLYAKLINYKPIYEAFGFMDIQPTFIGLIIV TMYISNPPNVLFQFITVIFKRRFEFEADKFAKNLGHGEALKSSLIKLQKDNLSYPLYDKL YSSWYHSHPELLERLEVIDKEN |
 Top
| |