| Protein: 66558220 XP_623951.1 PREDICTED: ras-related protein Rac1 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 49.5 | 50.5 | 0.980198 | ||
| Scape | 36.7 | 43.3 | 19.9 | 1.8442211 | 2.1758795 |
| Brain | 21.4 | 78.6 | 0.27226463 | ||
| Crop | 52.9 | 22.7 | 24.4 | 2.168033 | 0.9303279 |
| Eye | |||||
| Intestine | 41.8 | 27.8 | 30.4 | 1.375 | 0.9144737 |
| Leg, front | 34.3 | 36.2 | 29.4 | 1.1666666 | 1.2312925 |
| Leg, middle | 54.2 | 45.8 | 1.1834061 | ||
| Leg, rear | 34.3 | 36.6 | 29.1 | 1.1786941 | 1.2577319 |
| Mandibular gland | 57 | 43 | 1.3255814 | ||
| Rectum | 57 | 43 | 1.3255814 | ||
| Salivary gland, cerebral | 22 | 78 | 0.2820513 | ||
| Salivary gland, thoracic | 48.5 | 18.6 | 32.9 | 1.4741641 | 0.5653495 |
| Sternite | 39 | 61 | 0.6393443 | ||
| Tergite | 63.5 | 36.5 | 1.7397261 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 44.1 | 22.6 | 33.3 | 1.3243244 | 0.6786787 |
| Malpighian tubules | 35.2 | 33.4 | 31.3 | 1.1246006 | 1.0670927 |
| Nerve chord | 35 | 37.4 | 27.6 | 1.268116 | 1.3550725 |
| Poison sac | |||||
| Sting | 48.4 | 51.6 | 0.93798447 | ||
| Heart | 13.5 | 47.8 | 38.7 | 0.3488372 | 1.2351421 |
| Hypopharyngeal gland | 34 | 66 | 0.5151515 | ||
| Galea | 51.9 | 8.9* | 39.1 | 1.3273658 | 0.22762148 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.2 | 33.5 | 42.4 | 0.995283 | 0.7900943 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL |
 Top
| |