| Protein: 328788786 XP_393417.3 PREDICTED: 39S ribosomal protein L12 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 14 | 59.7 | 26.4 | 0.530303 | 2.2613637 |
| Scape | 58.8 | 41.2 | 1.4271845 | ||
| Brain | |||||
| Crop | 69* | 31 | 2.2258065 | ||
| Eye | |||||
| Intestine | 29.7 | 43.7 | 26.6 | 1.1165414 | 1.6428572 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 47 | 31.4 | 21.5 | 2.1860466 | 1.4604651 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 77.8 | 22.2 | 3.5045044 | ||
| Malpighian tubules | 34 | 26.1 | 39.9 | 0.85213035 | 0.65413535 |
| Nerve chord | 22.8 | 22.3 | 54.9 | 0.41530055 | 0.40619308 |
| Poison sac | |||||
| Sting | |||||
| Heart | 57.4 | 21 | 21.6 | 2.6574075 | 0.9722222 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.7 | 43.9 | 31.7 | 1.1892744 | 1.384858 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MYIMNTLRFICQRNIHQVRHFHKCIIQQTEAVAAMSTPPLSESVATENELPVNSKIEQIA NQIVCLNLIEVAQLSELLKKKLNLPDAMPMSNFVAAPVKGEEEVEEAAAVQTAFSVKLKS FNEKQKIALIKELKNILPNCNLVQAKKFVESAPNIIKSDLSKHDADELADLITKVGGIVE IV |
 Top
| |